Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR585 IGR583 IGR584 IGR586 IGR582 rs4, - CPn0733 udk, - CPn0735 mviN, - CPn0730 CPn0736 CPn0731 end4, - CPn0732 CPn0734 recC, - CPn0737 rs4, - CPn0733 udk, - CPn0735 mviN, - CPn0730 CPn0736 CPn0731 end4, - CPn0732 CPn0734 recC, - CPn0737 rs4, - CPn0733 udk, - CPn0735 mviN, - CPn0730 CPn0736 CPn0731 end4, - CPn0732 CPn0734 recC, - CPn0737
* Calculated from Protein Sequence

Gene ID: CPn0735

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
udk  

Definition:
uridine kinase

Gene Start:
825668

Gene Stop:
825000

Gene Length:
669

Molecular Weight*:
25744

pI*:
4.90

Net Charge*:
-8.88

EC:
2.7.1.48  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides; salvage of nucleosides and nucleotides  

Pathway: pathway table
Pyrimidine metabolism

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to uridine kinase sequences; e.g. residues 19-207 are 47% similar to (Z99117) uridine kinase [Bacillus subtilis]; residues 20-207 are 41% similar to URK_ECOLI; and residues 19-210 are 38% similar to URK1_MOUSE. BLAST also reveals similarity to MG382, UU332, and TP0667, all of which are predicted uridine kinase sequences.

BLAST reveals no significant similarity to C.trachomatis.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0572
COG name: Uridine kinase
Functional Class:  F
The phylogenetic pattern of COG0572 is ----Y-vceb-h--gpol-n-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 6-186 span six regions of similarity to blocks PR00988A-F (URIDINE KINASE SIGNATURE)

ProDom Summary:  Protein Domain Search
Residues 8-127 are 50% similar, and residues 128-207 are 46% similar to a defined domain of O32033_BACSU, defined as: KINASE TRANSFERASE ATP-BINDING URIDINE PHOSPHORIBULOKINASE PHOSPHOPENTOKINASE MONOPHOSPHOKINASE PROTEIN PRECURSOR PRK.



Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 8 to 199 (E-value = 1.5e-36) place CPn0735 in the PRK family which is described as Phosphoribulokinase / Uridine kinase family (PF00485)

PDB Hit:


Gene Protein Sequence:
MLMMLMMIIGITGGSGAGKTTLTQNIKEIFGEDVSVICQDNYYKDRSHYT
PEERANLIWDHPDAFDNDLLISDIKRLKNNEIVQAPVFDFVLGNRSKTEI
ETIYPSKVILVEGILVFENQELRDLMDIRIFVDTDADERILRRMVRDVQE
QGDSVDCIMSRYLSMVKPMHEKFIEPTRKYADIIVHGNYRQNVVTNILSQ
KIKNHLENALESDETYYMVNSK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTGATGATGCTTATGATGATTATTGGAATTACAGGAGGTTCTGGAGC
TGGGAAAACCACCCTAACCCAAAACATTAAAGAAATTTTCGGTGAGGATG
TGAGTGTTATCTGCCAAGATAATTATTACAAAGATAGATCTCATTATACT
CCTGAAGAACGTGCCAATTTAATTTGGGATCATCCGGACGCCTTTGATAA
TGACTTATTAATTTCAGACATAAAACGTCTAAAAAATAATGAGATTGTCC
AAGCCCCAGTTTTTGATTTTGTTTTAGGTAATCGATCTAAAACGGAGATA
GAAACGATCTATCCATCTAAAGTTATTCTTGTTGAAGGTATTCTGGTCTT
TGAAAATCAAGAACTTAGAGATCTTATGGATATTAGGATCTTTGTAGACA
CCGATGCTGATGAAAGGATACTACGCCGTATGGTTCGAGATGTTCAAGAA
CAAGGAGATAGCGTGGACTGCATCATGTCTCGTTATCTTTCTATGGTAAA
GCCTATGCATGAGAAATTTATAGAGCCGACTCGGAAATATGCTGATATCA
TTGTACATGGAAATTACCGACAAAACGTAGTAACAAATATTTTGTCACAG
AAAATTAAAAATCATTTAGAGAATGCCCTGGAAAGCGATGAGACGTATTA
TATGGTCAACTCTAAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy