Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR585 IGR581 IGR583 IGR584 IGR586 IGR582 rs4, - CPn0733 udk, - CPn0735 CPn0729 mviN, - CPn0730 CPn0736 CPn0731 end4, - CPn0732 CPn0734 recC, - CPn0737 rs4, - CPn0733 udk, - CPn0735 CPn0729 mviN, - CPn0730 CPn0736 CPn0731 end4, - CPn0732 CPn0734 recC, - CPn0737 rs4, - CPn0733 udk, - CPn0735 CPn0729 mviN, - CPn0730 CPn0736 CPn0731 end4, - CPn0732 CPn0734 recC, - CPn0737
* Calculated from Protein Sequence

Gene ID: CPn0734

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
823944

Gene Stop:
824918

Gene Length:
975

Molecular Weight*:
37432

pI*:
5.60

Net Charge*:
-10.03

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
This sequence appears to be a YceA related sequence (yceA).

Prosite PDOC00322 indicates that this sequence may be associated with the EC#
2.8.1.1.

Blast Summary:  PSI-Blast Search
CPn0734 is orthologously related to CT627: residues 1-323 of CPn0734 are 75% similar to residues 1-319 of CT627, a predicted conserved hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1054
COG name: Uncharacterized ACR, YceA family
Functional Class:  S
The phylogenetic pattern of COG1054 is -------ceb--------inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 113 to 212 (E-value = 3.8e-09) place CPn0734 in the Rhodanese family which is described as Rhodanese-like domain (PF00581)

PDB Hit:


Gene Protein Sequence:
MEKKYYALAYYYITRVDNPHEEIALHKKFLEDLDVSCRIYISEQGINGQF
SGYEPHAELYMQWLKERPNFSKIKFKIHHIKENIFPRITVKYRKELAALG
CEVDLSKQAKHISPQEWHEKLQENRCLILDVRNNYEWKIGHFDNATLPDI
QTFREFPEYAEKLAQECDPETTPVMMYCTGGIRCELYSPVLLEKGFKEVY
QLDGGVIAYGQQVGTGKWLGKLFVFDDRLAIPIDESDPDVAPIAECCHCQ
TPSDAYYNCANTDCNALFLCCDECIHQHQGCCGEECSQSPRVRKFDSSRG
NKPFRRAHLCEISENSESASCCLI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAAAAAATATTATGCACTAGCCTATTATTATATTACTCGTGTGGA
TAATCCACATGAAGAAATCGCTTTACACAAAAAGTTCTTAGAAGACCTCG
ATGTCTCTTGTCGTATTTACATTTCAGAGCAGGGTATCAATGGACAATTC
AGTGGTTATGAGCCCCATGCTGAGCTCTATATGCAATGGCTTAAAGAGCG
TCCTAATTTTTCTAAGATTAAGTTTAAAATCCATCATATTAAGGAAAATA
TCTTTCCTAGGATCACAGTAAAGTATCGAAAAGAACTTGCTGCCTTAGGA
TGTGAGGTAGATCTTTCCAAACAGGCAAAGCACATTTCTCCTCAAGAATG
GCACGAAAAACTCCAAGAAAATCGTTGCCTTATTCTAGATGTCCGAAATA
ACTATGAGTGGAAAATTGGTCACTTTGATAATGCGACTCTACCTGATATT
CAAACTTTCAGAGAGTTTCCAGAGTATGCTGAGAAGCTTGCTCAAGAATG
TGATCCCGAAACCACTCCCGTTATGATGTACTGTACGGGGGGAATTCGTT
GTGAGCTTTACTCTCCAGTTTTATTAGAAAAAGGCTTTAAAGAAGTCTAT
CAACTTGATGGTGGTGTCATTGCTTATGGACAACAAGTAGGCACCGGCAA
GTGGTTAGGAAAGCTCTTTGTTTTTGATGATCGCCTAGCTATTCCCATTG
ATGAGAGTGACCCTGATGTGGCCCCTATAGCAGAATGTTGTCATTGTCAA
ACTCCTAGTGACGCTTATTACAATTGTGCGAACACAGATTGCAATGCTCT
ATTTCTTTGCTGTGATGAATGTATTCATCAACATCAAGGATGTTGTGGTG
AAGAGTGCTCTCAAAGCCCTAGAGTTCGTAAATTTGATAGTTCACGAGGA
AATAAGCCTTTTCGACGTGCTCATTTGTGTGAGATCAGCGAAAACAGTGA
ATCAGCAAGTTGTTGTTTGATTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy