Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR585 IGR581 IGR580 IGR583 IGR584 IGR586 IGR582 rs4, - CPn0733 udk, - CPn0735 CPn0729 mviN, - CPn0730 CPn0736 CPn0728 CPn0731 end4, - CPn0732 CPn0734 recC, - CPn0737 rs4, - CPn0733 udk, - CPn0735 CPn0729 mviN, - CPn0730 CPn0736 CPn0728 CPn0731 end4, - CPn0732 CPn0734 recC, - CPn0737 rs4, - CPn0733 udk, - CPn0735 mviN, - CPn0730 CPn0736 CPn0728 CPn0729 CPn0731 end4, - CPn0732 CPn0734 recC, - CPn0737
* Calculated from Protein Sequence

Gene ID: CPn0733

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rs4  

Definition:
30S ribosomal protein S4

Gene Start:
823727

Gene Stop:
823098

Gene Length:
630

Molecular Weight*:
23989

pI*:
10.80

Net Charge*:
19.25

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
In Escherichia coli, S4 is known to bind
directly to 16S ribosomal RNA. Mutations in S4
have been shown to increase translational error
frequencies.

Blast Summary:  PSI-Blast Search
CPn0733 is similar to MG311 in M. genitalium,
UU498 in U. urealyticum and TP0306 in T. pallidum.

CPn0733 is orthologously related to CT626:
residues 1-209 are 83% similar to that of CT626.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0522
COG name: Ribosomal protein S4 and related proteins
Functional Class:  J
The phylogenetic pattern of COG0522 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 2 to 92 (E-value = 1.9e-18) place CPn0733 in the Ribosomal_S4 family which is described as Ribosomal protein S4/S9 N-terminal domain (PF00163)
Residues 93 to 140 (E-value = 4.6e-19) place CPn0733 in the S4 family which is described as S4 domain (PF01479)

PDB Hit:


Gene Protein Sequence:
MARYCGPKNRVARRFGANIFGRSRNPLLKKPHPPGQHGMQRKKKSDYGLQ
LEEKQKLKACYGMIMEKQLVKAFKEVIHKQGNVAQMFLERFECRLDNMVY
RMGFAKTIFAAQQLVAHGHILVNGRRVDRRSFFLRPGMQISLKEKSKRLQ
SVKDALESKDESSLPSYISLDKTGFKGELLVSPEQDQIEAQLPLPINISV
VCEFLSHRT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTCGATATTGTGGCCCTAAAAATAGAGTGGCAAGGCGTTTTGGTGC
GAACATCTTTGGCAGAAGCCGAAATCCTTTGTTAAAGAAGCCTCATCCTC
CAGGTCAACATGGTATGCAGAGAAAGAAAAAGTCTGACTATGGGCTCCAA
CTGGAAGAGAAACAGAAGCTTAAAGCTTGCTACGGCATGATTATGGAAAA
GCAGCTGGTTAAGGCTTTCAAAGAAGTTATACATAAGCAGGGAAATGTTG
CTCAAATGTTCCTTGAAAGATTTGAGTGTCGTCTTGATAACATGGTATAC
CGTATGGGCTTTGCAAAAACAATTTTTGCTGCTCAGCAGCTTGTTGCTCA
CGGACATATCTTAGTTAATGGGCGAAGAGTCGATAGACGCTCTTTCTTTT
TACGTCCTGGAATGCAGATTTCTCTAAAAGAAAAATCTAAACGACTTCAG
TCTGTAAAAGATGCCCTAGAAAGCAAAGACGAAAGTTCTCTGCCTTCTTA
CATTTCTTTAGATAAGACAGGCTTTAAAGGGGAATTGCTTGTATCTCCTG
AGCAAGATCAAATCGAGGCTCAATTGCCTCTACCTATCAACATTTCTGTT
GTTTGTGAGTTCCTATCTCATAGAACATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy