Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR585 IGR581 IGR580 IGR583 IGR584 IGR586 IGR582 rs4, - CPn0733 udk, - CPn0735 CPn0729 mviN, - CPn0730 CPn0736 CPn0728 CPn0731 end4, - CPn0732 CPn0734 rs4, - CPn0733 udk, - CPn0735 CPn0729 mviN, - CPn0730 CPn0736 CPn0728 CPn0731 end4, - CPn0732 CPn0734 rs4, - CPn0733 udk, - CPn0735 CPn0729 mviN, - CPn0730 CPn0736 CPn0728 CPn0731 end4, - CPn0732 CPn0734
* Calculated from Protein Sequence

Gene ID: CPn0731

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
821587

Gene Stop:
821763

Gene Length:
177

Molecular Weight*:
6463

pI*:
10.50

Net Charge*:
2.98

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any other known sequences.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
LSFLLIKPFSPPPLKQDYLFDISPYTSSEITIGGSYFKLNKASLQSSTLR
LRSISIIS$

Gene Nucleotide Sequence:  Sequence Viewer
TTGTCTTTTCTGCTCATTAAACCGTTTTCCCCTCCTCCTTTAAAACAAGA
CTATCTCTTCGACATTTCCCCCTATACTTCTTCAGAAATCACAATTGGAG
GAAGCTATTTCAAGCTAAATAAAGCATCTTTACAGAGCTCTACATTGCGT
TTGAGAAGCATAAGTATCATTTCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy