Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR585 IGR581 IGR580 IGR583 IGR584 IGR586 IGR579 IGR582 rs4, - CPn0733 udk, - CPn0735 CPn0729 mviN, - CPn0730 CPn0728 CPn0731 end4, - CPn0732 CPn0734 CPn0727 rs4, - CPn0733 udk, - CPn0735 CPn0729 mviN, - CPn0730 CPn0728 CPn0731 end4, - CPn0732 CPn0734 CPn0727 rs4, - CPn0733 udk, - CPn0735 CPn0729 mviN, - CPn0730 CPn0728 CPn0731 end4, - CPn0732 CPn0734 CPn0727
* Calculated from Protein Sequence

Gene ID: CPn0730

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
mviN  

Definition:
MVIN virulence factor

Gene Start:
821603

Gene Stop:
819960

Gene Length:
1644

Molecular Weight*:
61884

pI*:
10.20

Net Charge*:
15.84

EC:
 

Functional Class:
uncategorized  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
PSI-BLAST revealed similarity to MviN from Rickettsia prowazekii (accession CAA15035), the MviN homolog in E. coli (MVIN_ECOLI, accession P75932), MviN from T. pallidum (accession AAC65504), MviN from S. typhimurium (MVIN_SALTY, accession P37169), MviN from H. influenzae (MVIN_HAEIN, accession P44958), and MviN from V. cholerae (accession CAA05373).

CPn0730 is orthologously related to CT624: residues 3-537 of CPn0730 are 62% similar to residues 2-535 of CT624, a predicted MVIN virulence factor from C. trachomatis.
CPn0730 is also similar to TP0516, a predicted virulence factor from T. pallidum.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0728
COG name: Uncharacterized membrane protein, putative virulence factor MviN
Functional Class:  R
The phylogenetic pattern of COG0728 is ------vce-rhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 35 to 486 (E-value = 1.6e-194) place CPn0730 in the MVIN family which is described as MviN-like protein (PF03023)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
43  
61
transmembrane  
97  
114
transmembrane  
129  
146
transmembrane  
158  
175
transmembrane  
190  
207
transmembrane  
231  
248
transmembrane  
271  
288
transmembrane  
311  
328
transmembrane  
357  
374
transmembrane  
384  
401
transmembrane  
412  
429
transmembrane  
457  
474
transmembrane  
486  
510

PDB Hit:


Gene Protein Sequence:
MSRKDNEVSLARSIFNILSGTFCSRITGIFREIAMATYFGADPIVAAFWL
GFRTVFFLRKILGGLILEQAFIPHFEFLRAQSLDRAAFFFRRFSRLIKGS
TIIFTLLIEAVLWVVLQYVEEGTYDMILLTMILLPCGIFLMMYNVNGALL
HCENKFFGVGLAPVVVNIIWIFFVIAARHSDPRERIIGLSVALVIGFFFE
WLITVPGVWKFLLEAKSPPQEHDSVRALLAPLSLGILTSSIFQLNLLSDI
CLARYVHEIGPLYLMYSLKIYQLPIHLFGFGVFTVLLPAISRCVQREDHE
RGLKLMKFVLTLTMSVMIIMTAGLLLLALPGVRVLYEHGLFPQSAVYAIV
RVLRGYGASIIPMALAPLVSVLFYAQRQYAVPLFIGIGTALANIVLSLVL
GRWVLKDVSGISYATSITAWVQLYFLWYYSSKRLPMYSKLLWESIRRSIK
VMGTTMLACMITLGLNILTQTTYVIFLNPLTPLAWPLSSITAQAIAFLSE
SCIFLAFLFGFAKLLRVEDLINLASFEYWRGQRGLLQRQHVMQDTQN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCAGAAAAGACAATGAGGTTTCCTTAGCTCGTTCAATTTTTAATAT
ATTATCCGGAACTTTCTGTAGTCGTATTACAGGGATATTTCGAGAAATTG
CAATGGCAACCTATTTTGGAGCTGATCCAATTGTAGCTGCTTTCTGGTTA
GGTTTCCGTACTGTTTTTTTCTTAAGAAAAATTTTAGGAGGGCTCATTCT
AGAACAAGCCTTCATCCCTCATTTTGAATTTCTCCGTGCTCAAAGTCTCG
ATCGTGCGGCGTTTTTTTTCCGACGCTTTTCTAGATTGATTAAAGGCAGC
ACTATTATATTCACTCTGCTTATTGAAGCAGTATTGTGGGTAGTTCTTCA
ATACGTTGAAGAGGGGACTTACGATATGATTCTCCTTACTATGATACTCT
TGCCCTGTGGCATTTTCTTAATGATGTACAATGTAAACGGCGCTTTGCTT
CACTGTGAAAATAAGTTTTTCGGGGTGGGATTAGCTCCCGTAGTTGTAAA
TATCATTTGGATTTTCTTTGTTATAGCGGCTCGTCATTCAGATCCTAGAG
AGCGTATTATCGGTTTATCCGTGGCTCTAGTTATCGGGTTTTTCTTCGAA
TGGTTAATCACGGTTCCTGGAGTATGGAAATTTCTATTAGAAGCGAAGAG
CCCACCTCAAGAACACGATAGTGTTCGAGCTTTATTAGCTCCCTTATCTT
TGGGTATTTTAACTTCAAGCATCTTCCAGCTGAACCTTCTTTCTGATATC
TGCTTGGCTCGCTATGTACATGAAATAGGCCCTCTATATCTTATGTACTC
CTTAAAGATTTATCAGCTCCCCATACATCTCTTTGGCTTTGGTGTGTTTA
CCGTTCTCCTCCCAGCAATTTCTCGTTGTGTACAGCGAGAAGATCATGAG
AGGGGATTGAAACTTATGAAGTTCGTTCTCACCCTAACCATGTCCGTAAT
GATCATTATGACAGCAGGGCTATTGCTCTTAGCTTTACCTGGAGTCCGTG
TCCTTTATGAACACGGACTTTTCCCTCAGAGTGCTGTCTACGCTATTGTT
CGTGTATTGCGAGGTTATGGTGCCAGTATTATCCCTATGGCCTTGGCTCC
TTTAGTCTCTGTTCTTTTTTATGCACAGCGGCAGTATGCTGTTCCGCTCT
TTATAGGAATCGGTACGGCTTTGGCCAATATTGTTTTAAGCTTGGTTCTA
GGTCGTTGGGTTTTAAAAGACGTCTCGGGCATTTCCTATGCTACATCCAT
AACTGCTTGGGTGCAGTTATATTTCCTCTGGTATTATTCTTCGAAAAGAC
TCCCTATGTACTCTAAGTTACTTTGGGAGAGCATCCGGCGTTCCATAAAA
GTTATGGGAACCACTATGCTTGCTTGTATGATTACTCTAGGCTTAAATAT
CCTTACGCAAACTACATATGTAATTTTCTTAAACCCCCTCACACCACTTG
CTTGGCCCTTATCCTCCATAACGGCTCAAGCAATTGCTTTTTTATCTGAG
AGCTGCATTTTCTTGGCTTTTTTGTTTGGTTTTGCAAAACTGCTTCGAGT
AGAAGATCTTATTAATTTGGCTTCTTTTGAATACTGGCGTGGGCAACGGG
GTCTTTTGCAAAGACAACACGTGATGCAAGACACTCAAAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy