Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR581 IGR580 IGR583 IGR584 IGR579 IGR582 rs4, - CPn0733 CPn0729 mviN, - CPn0730 CPn0728 CPn0731 end4, - CPn0732 CPn0734 CPn0727 rs4, - CPn0733 CPn0729 mviN, - CPn0730 CPn0728 CPn0731 end4, - CPn0732 CPn0734 CPn0727 rs4, - CPn0733 CPn0729 mviN, - CPn0730 CPn0728 CPn0731 end4, - CPn0732 CPn0734 CPn0727
* Calculated from Protein Sequence

Gene ID: CPn0729

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
819857

Gene Stop:
818589

Gene Length:
1269

Molecular Weight*:
48362

pI*:
10.10

Net Charge*:
13.13

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0729 is orthologously related to CT623: residues 1-422 of CPn0729 are 60% similar to residues 15-446 of CT623, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
23

PDB Hit:


Gene Protein Sequence:
MKKQVYQWLASVVLLALTISGYAELPLSEQKVKSHTYTTLDEVKDYLSKR
GFVETRKQDGVLRIAGDVRARWLYFREDIKNPSDKDKYNPLPVNRYRSEF
YLYIDYRAERNWLSSKMNWTAIAGGENTAAGVDINRAFLGYRFYKNPETR
TDFFMEIGRSGLGDLFESEVQFQSNFDGLHIYWTRELSKDYPYQVIVHGG
PFVVNMTKKHYAWVVEGILNRLPKQFFVKCSVVDWNTFVPSETSTTEKAA
TNAMKYKYCVWQWLVGKHSQVPWINGQKKPLYLYGAFLMNPLAKATKTTL
NGKENLAWFIGGTLGGLRKAGDWSATVRYEYVEALSVPEIDVSGIGRGNL
LKFWFAQAIAANYDPKEANGFTNYKGFSALYMYGITDSLSFRAYGAYSKP
ANDKLGSDFTFRKFDLGIISAF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAACAGGTATATCAATGGTTAGCGAGTGTGGTTCTTTTAGCGCT
GACAATTTCAGGATACGCTGAACTTCCTCTCTCGGAACAAAAAGTAAAAA
GTCACACTTATACAACTTTAGACGAAGTCAAAGACTACTTAAGTAAACGG
GGTTTTGTAGAAACGCGAAAGCAAGATGGCGTTTTAAGAATAGCAGGAGA
TGTTAGAGCCCGGTGGTTGTATTTCAGAGAAGATATCAAAAACCCCTCAG
ATAAAGATAAATACAATCCCTTACCAGTAAATCGTTATCGTAGTGAATTT
TATCTCTATATTGATTATCGCGCTGAGAGGAACTGGCTGTCTTCAAAGAT
GAATTGGACAGCAATTGCAGGAGGGGAAAACACTGCAGCTGGTGTTGATA
TCAACAGAGCATTTCTAGGATATCGTTTTTATAAGAATCCCGAAACACGT
ACAGATTTCTTTATGGAAATCGGACGTTCTGGTTTAGGAGATCTCTTTGA
GTCAGAAGTCCAATTCCAAAGTAATTTTGACGGACTACATATATATTGGA
CTCGAGAACTTTCTAAGGACTATCCTTATCAAGTGATTGTTCATGGAGGT
CCTTTCGTCGTGAACATGACAAAAAAACATTATGCTTGGGTTGTAGAAGG
GATTCTCAATCGTTTGCCTAAACAGTTTTTTGTGAAATGTAGTGTTGTCG
ACTGGAACACATTCGTTCCTTCAGAAACCTCCACTACAGAAAAAGCTGCT
ACAAACGCTATGAAATACAAATACTGTGTTTGGCAGTGGCTCGTCGGAAA
GCATAGTCAGGTTCCTTGGATCAATGGACAGAAAAAGCCTCTATATCTTT
ATGGAGCTTTCTTAATGAACCCTTTAGCAAAGGCTACGAAGACTACGTTA
AATGGAAAAGAAAACCTAGCTTGGTTTATTGGAGGAACTTTAGGGGGACT
CAGAAAAGCTGGAGACTGGTCTGCCACAGTACGTTATGAGTATGTCGAAG
CCTTGTCGGTTCCAGAAATAGATGTTTCAGGGATTGGCCGTGGTAATTTA
TTAAAGTTTTGGTTCGCCCAAGCAATTGCTGCTAACTATGATCCTAAAGA
GGCTAATGGTTTTACAAATTATAAAGGATTTTCCGCTCTATATATGTATG
GCATCACAGATTCTCTATCATTCAGAGCTTATGGGGCTTACTCCAAACCA
GCAAACGATAAACTCGGCAGTGATTTTACTTTCCGAAAGTTTGATCTAGG
TATAATTTCAGCGTTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy