Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR581 IGR580 IGR578 IGR579 IGR582 CPn0729 mviN, - CPn0730 CPn0728 CPn0726 CPn0731 end4, - CPn0732 CPn0727 CPn0729 mviN, - CPn0730 CPn0728 CPn0726 CPn0731 end4, - CPn0732 CPn0727 CPn0729 mviN, - CPn0730 CPn0728 CPn0726 CPn0731 end4, - CPn0732 CPn0727
* Calculated from Protein Sequence

Gene ID: CPn0728

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
818477

Gene Stop:
816522

Gene Length:
1956

Molecular Weight*:
68209

pI*:
4.70

Net Charge*:
-15.70

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0728 is similar to CT622: residues 26-650 of CPn0728 are 35% similar to residues 19-646 of CT622, a predicted conserved hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
126
coil-coil  
127  
154
non-globular  
155  
256
coil-coil  
275  
322
coil-coil  
389  
435
non-globular  
437  
561

PDB Hit:


Gene Protein Sequence:
MVNPIGPGPIDETERTPPADLSAQGLEASAANKSAEAQRIAGAEAKPKES
KTDSVERWSILRSAVNALMSLADKLGIASSNSSSSTSRSADVDSTTATAP
TPPPPTFDDYKTQAQTAYDTIFTSTSLADIQAALVSLQDAVTNIKDTAAT
DEETAIAAEWETKNADAVKVGAQITELAKYASDNQAILDSLGKLTSFDLL
QAALLQSVANNNKAAELLKEMQDNPVVPGKTPAIAQSLVDQTDATATQIE
KDGNAIRDAYFAGQNASGAVENAKSNNSISNIDSAKAAIATAKTQIAEAQ
KKFPDSPILQEAEQMVIQAEKDLKNIKPADGSDVPNPGTTVGGSKQQGSS
IGSIRVSMLLDDAENETASILMSGFRQMIHMFNTENPDSQAAQQELAAQA
RAAKAAGDDSAAAALADAQKALEAALGKAGQQQGILNALGQIASAAVVSA
GVPPAAASSIGSSVKQLYKTSKSTGSDYKTQISAGYDAYKSINDAYGRAR
NDATRDVINNVSTPALTRSVPRARTEARGPEKTDQALARVISGNSRTLGD
VYSQVSALQSVMQIIQSNPQANNEEIRQKLTSAVTKPPQFGYPYVQLSND
STQKFIAKLESLFAEGSRTAAEIKALSFETNSLFIQQVLVNIGSLYSGYL
Q$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTAATCCTATTGGTCCAGGTCCTATAGACGAAACAGAACGCACACC
TCCCGCAGATCTTTCTGCTCAAGGATTGGAGGCGAGTGCAGCAAATAAGA
GTGCGGAAGCTCAAAGAATAGCAGGTGCGGAAGCTAAGCCTAAAGAATCT
AAGACCGATTCTGTAGAGCGATGGAGCATCTTGCGTTCTGCAGTGAATGC
TCTCATGAGTCTGGCAGATAAGCTGGGTATTGCTTCTAGTAACAGCTCGT
CTTCTACTAGCAGATCTGCAGACGTGGACTCAACGACAGCGACCGCACCT
ACGCCTCCTCCACCCACGTTTGATGATTATAAGACTCAAGCGCAAACAGC
TTACGATACTATCTTTACCTCAACATCACTAGCTGACATACAGGCTGCTT
TGGTGAGCCTCCAGGATGCTGTCACTAATATAAAGGATACAGCGGCTACT
GATGAGGAAACCGCAATCGCTGCGGAGTGGGAAACTAAGAATGCCGATGC
AGTTAAAGTTGGCGCGCAAATTACAGAATTAGCGAAATATGCTTCGGATA
ACCAAGCGATTCTTGACTCTTTAGGTAAACTGACTTCCTTCGACCTCTTA
CAGGCTGCTCTTCTCCAATCTGTAGCAAACAATAACAAAGCAGCTGAGCT
TCTTAAAGAGATGCAAGATAACCCAGTAGTCCCAGGGAAAACGCCTGCAA
TTGCTCAATCTTTAGTTGATCAGACAGATGCTACAGCGACACAGATAGAG
AAAGATGGAAATGCGATTAGGGATGCATATTTTGCAGGACAGAACGCTAG
TGGAGCTGTAGAAAATGCTAAATCTAATAACAGTATAAGCAACATAGATT
CAGCTAAAGCAGCAATCGCTACTGCTAAGACACAAATAGCTGAAGCTCAG
AAAAAGTTCCCCGACTCTCCAATTCTTCAAGAAGCGGAACAAATGGTAAT
ACAGGCTGAGAAAGATCTTAAAAATATCAAACCTGCAGATGGTTCTGATG
TTCCAAATCCAGGAACTACAGTTGGAGGCTCCAAGCAACAAGGAAGTAGT
ATTGGTAGTATTCGTGTTTCCATGCTGTTAGATGATGCTGAAAATGAGAC
CGCTTCCATTTTGATGTCTGGGTTTCGTCAGATGATTCACATGTTCAATA
CGGAAAATCCTGATTCTCAAGCTGCCCAACAGGAGCTCGCAGCACAAGCT
AGAGCAGCGAAAGCCGCTGGAGATGACAGTGCTGCTGCAGCGCTGGCAGA
TGCTCAGAAAGCTTTAGAAGCGGCTCTAGGTAAAGCTGGGCAACAACAGG
GCATACTCAATGCTTTAGGACAGATCGCTTCTGCTGCTGTTGTGAGCGCA
GGAGTTCCTCCCGCTGCAGCAAGTTCTATAGGGTCATCTGTAAAACAGCT
TTACAAGACCTCAAAATCTACAGGTTCTGATTATAAAACACAGATATCAG
CAGGTTATGATGCTTACAAATCCATCAATGATGCCTATGGTAGGGCACGA
AATGATGCGACTCGTGATGTGATAAACAATGTAAGTACCCCCGCTCTCAC
ACGATCCGTTCCTAGAGCACGAACAGAAGCTCGAGGACCAGAAAAAACAG
ATCAAGCCCTCGCTAGGGTGATTTCTGGCAATAGCAGAACTCTTGGAGAT
GTCTATAGTCAAGTTTCGGCACTACAATCTGTAATGCAGATCATCCAGTC
GAATCCTCAAGCGAATAATGAGGAGATCAGACAAAAGCTTACATCGGCAG
TGACAAAGCCTCCACAGTTTGGCTATCCTTATGTGCAACTTTCTAATGAC
TCTACACAGAAGTTCATAGCTAAATTAGAAAGTTTGTTTGCTGAAGGATC
TAGGACAGCAGCTGAAATAAAAGCACTTTCCTTTGAAACGAACTCCTTGT
TTATTCAGCAGGTGCTGGTCAATATCGGCTCTCTATATTCTGGTTATCTC
CAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy