Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR576 IGR577 IGR581 IGR580 IGR578 IGR579 CPn0725 CPn0724 CPn0729 CPn0728 CPn0726 CPn0727 CPn0725 CPn0724 CPn0729 CPn0728 CPn0726 CPn0727 CPn0724 CPn0729 CPn0728 CPn0726 CPn0725 CPn0727
* Calculated from Protein Sequence

Gene ID: CPn0727

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific conserved hypothetical protein

Gene Start:
813577

Gene Stop:
816195

Gene Length:
2619

Molecular Weight*:
96438

pI*:
4.80

Net Charge*:
-23.94

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
CPn0727 and its homologs seem high in glutamine (Q) residues. Most of these are conserved among the homologs.

Blast Summary:  PSI-Blast Search
CPn0727 is similar to CT619: residues 1-872 of CPn0727 are 38% similar to residues 1-877 of CT619, a predicted Chlamydia-specific protein from C. trachomatis. CPn0727 is also similar to CT711, CT620, CT621, CT712, all hypothetical proteins from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0727 is paralogous to CPn0852, CPn0726, CPn0853.

Pfam Summary:  Pfam Search
Residues 488 to 868 (E-value = 1.7e-192) place CPn0727 in the DUF582 family which is described as Protein of unknown function, DUF582 (PF04518)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
86  
166
coil-coil  
174  
213
coil-coil  
341  
383
coil-coil  
538  
584
non-globular  
601  
872

PDB Hit:


Gene Protein Sequence:
MSTFSIQNRLRTISGESTRIIKLDHKYSGFDPRSVPAINLEELNSGIYAL
RHLMNALQSENTNVAALLNPNNTIFPTTSWTDYKHSRPQASSPRAPSSQT
PTDIVSAAALALVLVIDGGLAELVASVTEIDLGALSTISTVRQLMASYLG
LTTLTAEQEKVVFSSSYVPSEKNLLEHVKQEKAAEIQAKQEEIKAVLEAK
GVSTEEIEAILKEYPDIYAADFFKEFIEEPLHTYRAKVGAPIQEMNENAI
QLLPTPPAITPDNVNEVNGMNTLSTILQAIDDAIKQAPALGGDQEIITIL
QTLVPLVDKTTFTKAEFDLIYTATQLPNTASLKLYLTDRQIAEYRGKITK
VYQNSIQNLSETKRVVENNRSMLETQLSMFQQAQNCFVTWISQANALNIA
ITNKYISAVLTTSMEMYGGLLCLSYMYERLADDEKAIFDKSVNEYLPIHI
VVGGSWVNGWIAKMAAYQELAEYSLGTAVTSQDQIKAYLQTRGNEFKATR
HFFHNIGDQMYQFANETVFGNCLTTANGAIQPDLGGFIREAMTNVGTVEA
DYVSNAQRILNEFNTAATAHVLQLQLQIAELQKKADDLDPGKASFTENRK
FAVAAWITSESLGDALISMILNSQLPKQEAFLKPLIEEINFNNLAANALN
SLLQITNEFSTTSVYYSLSSYLVQSKTGQNLFAGDYYETLLAAAREREYI
YRDTARCKQAINLVNGLLQKINSLPGATSAQKQEMLNATTYYQYSLSVTL
NQLTVLESLLAGLKMTLQTTSNNKYDKSVFKIESFDDWIPTLAALESFLT
SGFPNISATGGLGPLFTQVQSDQQTYTSQGQTQQLNLQNQMTTIQQEWTL
VSTSMQVLNGILSQLAGAIYSN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTACCTTTTCTATCCAAAATCGACTAAGAACCATTTCAGGTGAAAG
TACTCGAATCATCAAGCTGGACCATAAGTACTCTGGTTTTGATCCCAGAT
CAGTGCCTGCGATAAATTTAGAAGAGTTAAATTCAGGGATTTATGCTCTA
AGGCATTTAATGAACGCCCTGCAATCAGAAAATACCAATGTTGCTGCTTT
ATTAAACCCAAACAATACGATCTTCCCCACAACATCTTGGACAGATTACA
AGCATTCGCGTCCGCAAGCTAGCTCTCCAAGAGCACCCTCATCACAAACT
CCCACAGATATCGTATCAGCAGCAGCTCTTGCTTTAGTTCTTGTTATTGA
CGGAGGTCTAGCGGAATTAGTGGCCTCCGTTACAGAAATTGATCTCGGAG
CTTTATCCACTATATCCACAGTTCGTCAGTTAATGGCGAGCTACCTCGGT
TTGACAACTCTAACAGCTGAACAAGAAAAGGTTGTATTTTCCAGCTCCTA
TGTTCCTTCAGAAAAAAATCTCCTTGAACATGTAAAACAAGAAAAAGCTG
CTGAAATCCAAGCTAAGCAAGAAGAAATAAAAGCAGTATTAGAAGCTAAA
GGAGTCTCTACTGAAGAGATCGAAGCGATACTTAAGGAATATCCTGATAT
CTATGCAGCAGATTTCTTCAAAGAGTTTATAGAAGAGCCTTTACATACAT
ATCGTGCAAAAGTCGGCGCACCGATCCAAGAGATGAATGAGAACGCGATT
CAGCTGCTTCCTACACCTCCTGCGATCACTCCTGACAATGTCAATGAAGT
CAACGGAATGAACACCCTCAGCACTATTTTACAAGCTATAGATGATGCTA
TTAAACAAGCTCCTGCACTTGGTGGGGATCAGGAAATCATTACTATACTA
CAAACTTTGGTTCCCCTAGTCGATAAGACCACGTTTACAAAAGCTGAATT
CGATCTTATTTACACAGCAACACAACTTCCTAATACAGCATCTTTAAAAC
TCTACCTTACGGATAGACAAATTGCTGAGTATCGAGGGAAAATCACGAAA
GTATATCAAAATTCTATCCAAAATCTCTCTGAGACAAAACGTGTAGTTGA
AAACAACCGAAGCATGCTAGAAACACAACTCTCCATGTTCCAACAAGCAC
AAAATTGCTTTGTTACTTGGATTAGTCAAGCCAATGCACTTAACATAGCC
ATCACTAATAAATATATTTCTGCTGTACTTACGACTTCTATGGAGATGTA
CGGAGGTCTCCTTTGCCTTTCTTATATGTACGAAAGGTTAGCCGATGATG
AAAAAGCAATTTTTGACAAAAGTGTGAATGAGTATTTACCGATTCACATC
GTTGTTGGTGGTTCATGGGTAAATGGCTGGATAGCAAAAATGGCAGCCTA
TCAAGAACTCGCGGAATACTCTTTAGGAACCGCAGTTACAAGTCAAGATC
AAATCAAAGCTTATTTACAAACACGAGGGAATGAGTTTAAAGCTACGCGT
CATTTTTTCCATAATATTGGGGATCAAATGTACCAATTTGCTAATGAGAC
TGTCTTTGGAAATTGTCTTACAACAGCAAATGGTGCGATACAGCCCGATT
TAGGTGGTTTTATCAGAGAAGCAATGACGAATGTTGGAACTGTTGAAGCC
GATTATGTAAGCAATGCTCAGAGGATCCTAAATGAATTTAATACGGCTGC
AACTGCGCATGTTTTACAATTACAATTACAAATAGCTGAGTTACAAAAGA
AAGCAGATGACTTAGACCCAGGAAAAGCCTCTTTCACTGAGAACCGTAAA
TTTGCTGTTGCTGCTTGGATCACATCGGAGAGCTTAGGAGATGCTTTAAT
TTCTATGATTTTAAACTCTCAGCTACCAAAGCAAGAGGCTTTTTTAAAAC
CTTTGATCGAAGAAATTAACTTCAATAACCTCGCAGCGAATGCCTTAAAC
AGCTTGCTACAGATTACCAATGAATTTTCTACGACTTCTGTCTACTATAG
CCTCTCTTCCTATTTAGTTCAGAGTAAAACTGGACAAAACCTGTTTGCTG
GTGATTACTATGAAACACTTCTAGCTGCAGCTAGAGAACGGGAGTATATT
TATCGCGACACTGCGAGATGTAAACAAGCGATTAATCTAGTCAATGGACT
TCTCCAAAAAATTAACTCTCTTCCAGGGGCTACCTCAGCACAAAAACAAG
AAATGCTTAACGCAACTACCTATTATCAATACAGCTTATCAGTCACTTTA
AACCAACTTACTGTATTAGAATCTTTACTCGCGGGTCTCAAAATGACTCT
TCAGACAACTAGTAATAACAAATACGACAAAAGTGTGTTTAAAATTGAAA
GTTTTGATGACTGGATTCCAACTCTAGCTGCTTTGGAAAGTTTTCTAACT
AGTGGATTCCCTAATATCAGTGCGACAGGAGGCCTAGGTCCTTTATTTAC
CCAGGTGCAATCCGATCAGCAAACGTATACTTCTCAAGGCCAGACACAGC
AGTTGAACCTACAAAACCAAATGACCACTATCCAACAGGAGTGGACATTA
GTTTCCACATCCATGCAAGTATTAAACGGTATTTTATCACAGCTTGCTGG
TGCCATCTATTCCAACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy