Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_3 IGR575 IGR576 IGR577 IGR578 IGR579 IGR574 CPn0725 CPn0724 CPn0728 CPn0726 CPn0720 yhbG, - CPn0723 kdsA, - CPn0721 CPn0727 CPn0725 CPn0724 CPn0728 CPn0726 CPn0720 yhbG, - CPn0723 kdsA, - CPn0721 CPn0727 CPn0724 CPn0728 CPn0726 CPn0725 CPn0720 yhbG, - CPn0723 kdsA, - CPn0721 CPn0727 CPn0722 CPn0722
* Calculated from Protein Sequence

Gene ID: CPn0726

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific conserved hypothetical protein

Gene Start:
813372

Gene Stop:
810877

Gene Length:
2496

Molecular Weight*:
91048

pI*:
4.90

Net Charge*:
-21.17

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0726 is orthologously related to CT620: residues 6-831 of CPn0726 are 43% similar to residues 12-838 of CT620, a predicted Chlamydia-specific hypothetical protein from C. trachomatis. CPn0726 is also similar to CT621, CT711, CT712, and CT619, all hypothetical proteins from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0726 is paralogous to CPn0727, CPn0852, CPn0853, all hypothetical proteins from C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 438 to 828 (E-value = 2.5e-202) place CPn0726 in the DUF582 family which is described as Protein of unknown function, DUF582 (PF04518)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
37  
75
coil-coil  
366  
393
coil-coil  
525  
559
non-globular  
601  
650
coil-coil  
651  
717

PDB Hit:


Gene Protein Sequence:
MIYSTSISTFYKKLSLVSSMHSFAQRHRESLEHIANYEKTTAERDILKRL
IEVLDQRASERYRSAVEKLHKYEVERATVAKSIPVAAIHEKPLSSTHASV
QVTASTPAATGSGVGAYYNAVKQKWAQDLIVELNTVMTTIMASVNSKNPA
NKDVFDKLNTELQALVAAGNNLTEENFQTLYNFPEEIFTAIQRADTFTGG
MKTDFTNQLAGKYGNQATLTQTFADGRVEGFKDILTAVQGVLTPEQFTIF
AEIATELQALADHVGNFDEAGLQRIEDAGEKLAAVINSSDLTRNDKIMFC
QHITDLYSDQVAALGSFDTVLDASIYVNQHQGTMFSNLSSFVGSLIGTFA
PIDLSSSQGDISSAALAGALQTARGLNSRFNELTAEQQKLINECIKSLVT
FKCGEHLGAIWAYFTASTVVALNPTATMDHVKAAILEEAKELDNSSFQLA
SSIKSAMTSIVNSSGSFSVTVNSSTLQYTIYSEKNGKVEINQILLNYGST
GFLPEITKLAKTNAESTARSYFRFKALAAVESENVQNKIEDLQSQLQQFT
NMKTELFDGQLLSQASELRALPLPSAVASVLIDRYMPKEVDYLNEIYKKL
YYSNLGSSIGNSIIDAISQYVNGATYFNFASYVGQQPAVGAGGANAFPGS
QESAQAKLDQERKQAALYLQETRGALTVIEEQRARVLKDDKITNEQRSTI
LDSLRNYEDNINSISGSLVLLQNYLQPLSIAGGSVAGTFEVKEGQEQWQA
RLQILEEALVSGLVGNMINGGMFPLQSTIQSDQQSFADMGQNFQLDLQMH
LTSMQQEWTVVATSLQLLNQMYLSLARSLTG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTTATAGCACTTCTATTTCAACATTTTATAAAAAACTCTCTCTAGT
GTCTTCAATGCATTCTTTTGCACAAAGACACAGGGAATCTTTAGAACATA
TCGCTAATTATGAGAAGACTACAGCGGAACGTGACATACTAAAACGGTTG
ATCGAAGTTTTGGATCAGAGGGCGAGCGAGCGCTACCGCTCTGCCGTCGA
GAAGCTACACAAATATGAAGTGGAGCGTGCGACAGTAGCGAAGTCTATTC
CTGTGGCAGCCATTCATGAGAAACCTCTTTCCTCTACACATGCATCTGTT
CAGGTTACAGCAAGTACGCCAGCAGCTACAGGATCTGGAGTCGGGGCCTA
TTATAACGCAGTAAAACAGAAGTGGGCGCAAGATCTTATCGTTGAGCTTA
ATACGGTTATGACCACTATCATGGCCTCAGTTAATAGTAAGAATCCTGCA
AATAAAGATGTCTTTGATAAATTAAATACTGAACTTCAGGCTTTAGTCGC
TGCGGGGAATAATTTAACAGAAGAGAATTTTCAGACTCTCTACAATTTCC
CAGAGGAGATCTTCACTGCAATCCAACGAGCAGATACGTTTACTGGGGGA
ATGAAAACAGACTTTACGAACCAGTTGGCAGGCAAATATGGAAATCAAGC
TACTTTAACTCAAACGTTTGCAGACGGTAGAGTCGAAGGGTTCAAAGACA
TCCTTACAGCGGTACAAGGAGTCCTTACACCAGAGCAGTTTACTATCTTT
GCTGAGATTGCGACAGAGCTGCAGGCTTTAGCAGATCATGTAGGTAATTT
TGATGAAGCAGGATTACAACGGATTGAGGATGCTGGAGAAAAACTCGCCG
CAGTCATTAATTCTTCTGACCTGACTAGAAATGATAAAATTATGTTCTGT
CAACATATAACAGACTTATACTCAGATCAAGTTGCGGCTTTAGGATCCTT
TGATACGGTACTTGATGCAAGTATCTATGTTAACCAGCATCAAGGAACGA
TGTTTTCCAATTTGTCTAGCTTTGTTGGCTCTTTAATTGGAACTTTTGCT
CCAATTGATCTGAGTTCCTCTCAAGGTGATATTAGTAGTGCGGCTTTAGC
TGGAGCTCTACAAACAGCCCGAGGGTTAAATTCTCGTTTCAATGAGTTAA
CTGCTGAGCAACAGAAACTGATTAATGAGTGTATAAAATCTTTGGTTACC
TTTAAGTGTGGTGAGCACCTTGGTGCTATCTGGGCTTATTTTACAGCATC
TACTGTAGTTGCTTTAAACCCTACTGCAACCATGGACCACGTTAAAGCTG
CTATCCTTGAAGAAGCTAAAGAATTAGATAACTCTAGTTTTCAGTTAGCA
TCATCTATAAAATCCGCGATGACTTCAATTGTAAATTCAAGCGGTTCCTT
TTCCGTAACGGTGAACTCAAGTACCTTACAATATACTATATATTCTGAGA
AAAACGGCAAAGTTGAGATTAATCAAATCCTGTTAAATTATGGATCTACA
GGATTTTTGCCAGAAATTACGAAACTAGCAAAAACAAACGCCGAATCTAC
GGCACGAAGTTATTTTCGGTTTAAGGCTCTTGCTGCTGTAGAATCAGAAA
ATGTACAGAACAAAATCGAAGATCTTCAGAGTCAATTGCAACAATTCACC
AATATGAAAACAGAACTGTTTGATGGGCAATTGTTATCACAGGCTAGTGA
ATTACGGGCTCTCCCCCTACCTTCGGCAGTCGCCTCTGTGTTGATCGATC
GTTATATGCCTAAAGAGGTCGATTATCTAAATGAAATCTATAAGAAGCTA
TATTATAGCAACTTAGGATCTTCTATCGGAAATTCCATTATTGATGCGAT
TTCTCAATATGTCAATGGAGCTACGTATTTCAATTTTGCTAGTTATGTGG
GACAACAGCCGGCAGTAGGTGCTGGGGGAGCGAATGCCTTCCCAGGATCT
CAAGAAAGCGCTCAGGCAAAGTTGGATCAGGAGCGAAAGCAAGCTGCTTT
GTATCTCCAAGAAACACGGGGAGCTCTTACAGTTATTGAAGAACAAAGAG
CTAGAGTGCTTAAAGATGATAAAATCACGAATGAGCAGCGCTCCACGATT
TTAGATTCCTTAAGGAACTACGAGGACAACATCAATTCTATCTCAGGTTC
TTTAGTGTTATTGCAAAATTACTTACAGCCTTTGTCTATAGCTGGAGGTT
CTGTAGCAGGAACTTTTGAAGTTAAAGAGGGGCAAGAGCAATGGCAAGCG
CGATTGCAGATTCTTGAAGAAGCTTTAGTGTCCGGGTTAGTAGGAAATAT
GATTAATGGGGGTATGTTCCCACTGCAATCTACAATACAGTCAGACCAGC
AATCTTTTGCGGATATGGGACAGAACTTCCAGTTAGATTTGCAGATGCAC
CTGACTTCTATGCAGCAGGAGTGGACTGTAGTCGCGACTTCTCTACAGCT
TTTAAATCAAATGTACTTAAGTTTAGCACGAAGCCTGACAGGATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy