Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_3 IGR575 IGR576 IGR577 IGR573 IGR578 IGR572 IGR574 CPn0725 CPn0724 CPn0726 CPn0720 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 CPn0727 CPn0725 CPn0724 CPn0726 CPn0720 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 CPn0727 CPn0724 CPn0726 CPn0725 CPn0720 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 CPn0727 CPn0722 CPn0722
* Calculated from Protein Sequence

Gene ID: CPn0725

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
810811

Gene Stop:
810584

Gene Length:
228

Molecular Weight*:
8554

pI*:
4.20

Net Charge*:
-8.33

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0725 is similar to CT652.1: residues 16-71 of CPn0725 are 58% similar to residues 1-56 of CT652.1, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MFFAPLLYESLRRGLMHPTSHMQQQLARLEFINDQLTTELEHVNELLCSL
GFPEGLTTIKAIAEEVLSDDEPLLD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTTTCGCTCCTCTTCTTTATGAATCGTTACGGAGGGGTCTTATGCA
TCCAACATCTCATATGCAACAGCAACTCGCTCGCTTGGAGTTTATCAACG
ACCAGCTGACTACAGAGTTAGAACATGTAAATGAATTATTATGTAGTTTA
GGTTTCCCTGAAGGTCTCACTACAATCAAGGCAATCGCAGAGGAAGTCCT
CTCTGATGACGAACCTCTACTAGATTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy