Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_3 IGR575 IGR576 IGR577 IGR573 IGR578 IGR572 IGR574 CPn0725 CPn0724 CPn0726 CPn0720 CPn0717 CPn0718 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 CPn0727 CPn0725 CPn0724 CPn0726 CPn0720 CPn0717 CPn0718 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 CPn0727 CPn0724 CPn0726 CPn0725 CPn0720 CPn0718 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 CPn0727 CPn0722 CPn0722 CPn0717
* Calculated from Protein Sequence

Gene ID: CPn0724

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
810527

Gene Stop:
809703

Gene Length:
825

Molecular Weight*:
30877

pI*:
8.70

Net Charge*:
11.78

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any other known sequences.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
42  
92

PDB Hit:


Gene Protein Sequence:
MLLGFLCDCPCASWQCAAVANCYDSVFMSRPEHKPNIPYITKATRRGLRM
KTLAYLASLKDARQLAYDFLKDPGSLARLAKALIAPKEALQEGNLFFYGC
SNIEDILEEMRRPHRILLLGFSYCQKPKACPEGRFNDACRYDPSHPTCAS
CSIGTMMRLNARRYTTVIIPTFIDIAKHLHTLKKRYPGYQILFAVTACEL
SLKMFGDYASVMNLKGVGIRLTGRICNTFKAFKLAERGVKPGVTILEEDG
FEVLARILTEYSSAPFPRDFCEIH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTTCTAGGGTTTTTGTGTGACTGCCCCTGTGCTTCGTGGCAGTGTGC
GGCCGTTGCTAATTGTTATGATTCCGTATTTATGTCTAGACCAGAGCACA
AACCTAATATTCCTTATATTACTAAAGCTACAAGACGGGGTCTGCGTATG
AAGACGCTTGCTTATCTGGCCTCTTTAAAAGATGCTAGACAGCTTGCCTA
TGATTTTCTGAAAGATCCTGGTTCTTTAGCTCGGTTAGCTAAGGCTTTGA
TAGCTCCTAAGGAGGCCTTACAGGAGGGCAACCTATTTTTTTATGGCTGT
AGTAATATTGAGGATATTTTAGAGGAGATGCGTCGTCCTCATAGAATCCT
TTTGTTAGGATTTTCTTATTGTCAAAAGCCTAAGGCATGTCCTGAAGGGC
GTTTCAATGATGCTTGTCGGTATGATCCTTCACATCCTACATGTGCCTCA
TGTTCTATAGGGACCATGATGCGGCTGAATGCTCGTAGATACACTACTGT
GATCATCCCTACATTTATAGATATCGCAAAACATTTACACACTTTAAAAA
AGCGCTACCCTGGATATCAAATTCTCTTTGCAGTTACTGCTTGTGAACTT
TCCTTAAAAATGTTTGGAGATTATGCCTCCGTAATGAACTTAAAGGGTGT
GGGCATCAGACTCACAGGACGTATTTGCAATACATTTAAGGCATTTAAAT
TAGCTGAGCGAGGAGTCAAACCAGGAGTCACTATCCTAGAAGAAGATGGC
TTTGAGGTATTAGCAAGGATTCTTACAGAATACAGTAGCGCTCCTTTCCC
TAGAGACTTTTGTGAGATCCATTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy