Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_3 IGR575 IGR576 IGR577 IGR571 IGR573 IGR578 IGR572 IGR574 CPn0725 CPn0724 CPn0726 CPn0720 CPn0717 CPn0718 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 gyrA, - CPn0716 CPn0727 CPn0725 CPn0724 CPn0726 CPn0720 CPn0717 CPn0718 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 gyrA, - CPn0716 CPn0727 CPn0724 CPn0726 CPn0725 CPn0720 CPn0718 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 gyrA, - CPn0716 CPn0727 CPn0722 CPn0722 CPn0717
* Calculated from Protein Sequence

Gene ID: CPn0723

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yhbG  

Definition:
Probable ABC transporter ATP-binding protein (basic)

Gene Start:
808984

Gene Stop:
809706

Gene Length:
723

Molecular Weight*:
26510

pI*:
9.20

Net Charge*:
6.96

EC:
 

Functional Class:
transport and binding proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to ABC transporter sequences; e.g. residues 3-238 are 47% similar to YHBG_THIFE; residues 1-238 are 47% similar to YHBG_HAEIN; and residues 1-240 are 44% similar to (AJ235272) ABC TRANSPORTER ATP-BINDING PROTEIN (abcT2) [Rickettsia prowazekii].
CPn0723 is similar to CT653, CT152, CT264, CT180, CT130, and CT416, TP0786, MG179, TP0227, TP0881, TP0652, TP0120, UU539, and UU093, all predicted ABC transporter proteins.
Residues 1-239 are 95% similar to CT653.

COGS Summary:  COGS Search
BeTs to 9 clades of COG1137
COG name: ABC-type (unclassified) transport system, ATPase component
Functional Class:  R
The phylogenetic pattern of COG1137 is -----qvce--huj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 34-45 and 137-168 represent blocks BL00211A-B (ABC transporters family proteins) with a combined E-value of 2.6e-22.

ProDom Summary:  Protein Domain Search
Residues 182-235 are 90% similar to a defined domain of P71151_CHLTR; defined as: ATP-BINDING TRANSPORT PROTEIN TRANSPORTER ABC MEMBRANE INNER SUGAR SYSTEM PUTATIVE.

Paralogs:  Local Blast Search
Numerous probable paralogs found in C.pneumoniae; CPn0248, CPn0280, CPn0231, CPn0413, CPn0348, CPn0191, CPn0542, CPn0691, CPn0682, CPn0201, CPn0683, CPn0202, and CPn0023. Residues 18-219 are 31% similar to CPn0248.

Pfam Summary:  Pfam Search
Residues 29 to 212 (E-value = 1.2e-49) place CPn0723 in the ABC_tran family which is described as ABC transporter (PF00005)

PDB Hit:


Gene Protein Sequence:
MPILSVCNLVKKYNKKPVTNDVSFQINPGEIVGLLGPNGAGKTTAFYLTV
GLIRPDSGKIIFKNVDVTKKTMDHRARLGIGYLAQEPTIFKELTVQDNLI
CILEIIYKARKQQSHLLNTLVDDLQLGSCLHKKAGTLSGGERRRLEIACV
LALNPSVLLLDEPFANVDPLVIQNVKYLIKILAGRGIGILITDHNAKELL
SIADRCYLIIDGKIFFEGSSSQMISNPMVKQHYLGDSFSY$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTATACTTTCTGTGTGTAATCTCGTAAAGAAGTATAACAAGAAGCC
CGTGACAAATGATGTGTCTTTCCAAATCAACCCCGGGGAGATTGTCGGCC
TACTCGGCCCTAACGGAGCAGGAAAAACAACAGCATTTTATCTTACTGTA
GGCTTAATTCGCCCTGACTCTGGGAAGATTATCTTTAAAAATGTCGATGT
CACCAAAAAAACTATGGACCATCGTGCACGACTGGGAATCGGTTATCTTG
CTCAAGAACCCACAATTTTTAAAGAACTCACAGTTCAAGATAACCTGATT
TGCATTTTAGAGATCATTTACAAAGCGCGTAAACAACAATCCCATCTTTT
AAACACCCTGGTTGATGATTTGCAACTAGGTTCCTGCCTCCATAAAAAGG
CAGGAACCCTATCTGGAGGGGAACGACGAAGATTGGAGATCGCCTGTGTA
TTAGCTTTAAATCCCAGCGTATTGTTGTTAGATGAGCCTTTTGCGAATGT
AGATCCTCTCGTCATTCAAAACGTCAAGTACCTAATTAAAATTCTAGCAG
GACGTGGAATCGGCATTCTAATTACAGATCACAATGCTAAAGAGCTCCTT
TCTATTGCTGATAGGTGTTATTTGATTATTGATGGGAAGATCTTCTTTGA
AGGGTCTTCAAGCCAAATGATCAGTAACCCTATGGTAAAGCAACATTACC
TGGGAGACTCGTTCTCATACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy