Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_3 IGR575 IGR576 IGR577 IGR571 IGR573 IGR578 IGR572 IGR574 CPn0725 CPn0724 CPn0726 CPn0720 CPn0717 CPn0718 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 gyrA, - CPn0716 CPn0727 CPn0725 CPn0724 CPn0726 CPn0720 CPn0717 CPn0718 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 gyrA, - CPn0716 CPn0727 CPn0724 CPn0726 CPn0725 CPn0720 CPn0718 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 gyrA, - CPn0716 CPn0727 CPn0722 CPn0722 CPn0717
* Calculated from Protein Sequence

Gene ID: CPn0722

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
808489

Gene Stop:
808977

Gene Length:
489

Molecular Weight*:
18525

pI*:
7.80

Net Charge*:
2.81

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0722 is orthologously related to CT654: residues 1-162 of CPn0722 are 42% similar to residues 1-162 of CT654, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 161 (E-value = 8.4e-141) place CPn0722 in the DUF1137 family which is described as Protein of unknown function (DUF1137) (PF06587)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
25

PDB Hit:


Gene Protein Sequence:
MTKFLYCGLFYSLGLLVLAFGTMVAIIQVDQICDVSCMNKHFQESPPFLK
IKKVNVSKQICSPEERFFHCKIDKSCMELHFPQSSYSCKEYLTRISGHIL
TQNFEKQMQFRGNSGLLNYQDGSLHVYDCRFQVDPVPGYGSPDKEDSSSG
GMKTLYLSLFRN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAAAATTTCTATACTGCGGGCTCTTTTATTCTCTAGGACTACTTGT
CTTGGCTTTTGGGACTATGGTAGCCATTATTCAAGTGGACCAGATTTGCG
ATGTTTCCTGTATGAACAAGCACTTCCAAGAATCCCCCCCTTTTTTAAAA
ATAAAAAAGGTGAATGTCTCCAAACAAATTTGCTCTCCTGAAGAACGATT
CTTCCATTGTAAAATTGATAAATCGTGTATGGAACTGCATTTTCCTCAGT
CTAGTTATTCCTGTAAAGAATACCTCACCCGGATCTCAGGGCATATTCTA
ACACAAAATTTTGAAAAGCAAATGCAATTCCGAGGAAACTCAGGATTACT
AAATTACCAAGATGGTTCCTTACATGTGTATGACTGCCGTTTCCAAGTAG
ATCCTGTACCTGGGTATGGGTCTCCAGATAAGGAGGACAGTTCTTCAGGA
GGTATGAAAACCCTCTATTTATCTTTATTCAGGAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy