Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_3 IGR570 IGR575 IGR576 IGR577 IGR571 IGR573 IGR572 IGR574 CPn0725 CPn0724 CPn0726 CPn0720 CPn0717 CPn0718 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 gyrA, - CPn0716 gyrB, - CPn0715 CPn0725 CPn0724 CPn0726 CPn0720 CPn0717 CPn0718 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 gyrA, - CPn0716 gyrB, - CPn0715 CPn0724 CPn0726 CPn0725 CPn0720 CPn0718 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 gyrA, - CPn0716 gyrB, - CPn0715 CPn0722 CPn0722 CPn0717
* Calculated from Protein Sequence

Gene ID: CPn0721

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
kdsA  

Definition:
2-dehydro-3-deoxyphosphooctonate aldolase

Gene Start:
807683

Gene Stop:
808492

Gene Length:
810

Molecular Weight*:
28980

pI*:
5.40

Net Charge*:
-4.27

EC:
4.1.2.16  

Functional Class:
cell envelope; surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Fructose and mannose metabolism

Comment:
This enzyme is involved in the first step of liposaccharide
biosynthesis, converting PEP and D-arabinose-5-phosphate to
2-dehdro-3-deoxy-D-octonate-8-phosphate.

Blast Summary:  PSI-Blast Search
CPn0721 is orthologous to CT655, a predicted 2-dehydro-3-deoxyphosphooctonate aldolase:
residues 4-268 are 69% similar to CT655. No similarity to T.pallidum,
M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0722
COG name: DAHP synthase/3-Deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
Functional Class:  E,M
The phylogenetic pattern of COG0722 is ----YqvcEb-Huj----INx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 263 (E-value = 6.8e-127) place CPn0721 in the DAHP_synth_1 family which is described as DAHP synthetase I family (PF00793)

PDB Hit:


Gene Protein Sequence:
MFNNKMILIAGPCVIEGEDITLEIAGKLQSILAPYSDRIQWFFKSSYDKA
NRSSLNSFRGPGLTEGLRILAKVKETFGVGILTDVHTPQDAYAAAEVCNI
LQVPAFLCRQTDLLVATAETGAIVNLKKGQFLSPWDMEGPINKVLSTGNN
KILLTERGCSFGYNNLVSDMRSIPVLSRSGFPVIFDATHSVQLPGALSTE
SGGLTEFVPTLSRAALAAGAHGLFIETHTNPKIAKSDAASMLSLEEFAAL
LPTWDQLFTCVSSFDMVSA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTCAATAACAAAATGATCCTAATTGCTGGCCCCTGTGTTATTGAGGG
GGAAGATATTACATTGGAAATCGCAGGGAAATTACAGTCCATACTCGCCC
CTTATTCGGATCGGATCCAATGGTTTTTTAAAAGCAGTTACGACAAAGCA
AATCGCTCTTCCCTAAACTCATTTCGAGGGCCTGGTTTGACAGAGGGATT
GCGCATCCTTGCCAAAGTCAAAGAAACTTTTGGCGTGGGCATTCTTACAG
ATGTCCATACGCCTCAAGACGCTTACGCGGCTGCCGAAGTCTGCAATATC
CTTCAGGTACCTGCGTTCCTCTGCAGACAAACCGACCTCCTCGTTGCAAC
TGCAGAAACTGGCGCTATAGTAAATTTAAAAAAAGGGCAGTTTCTCTCCC
CTTGGGATATGGAAGGCCCAATAAATAAAGTACTCTCTACAGGAAATAAC
AAAATCTTACTTACAGAAAGAGGGTGTAGCTTCGGTTACAATAACCTTGT
TTCTGATATGCGCTCGATTCCTGTTTTATCCCGTTCAGGATTTCCTGTAA
TTTTTGATGCCACGCACTCCGTGCAGCTCCCTGGAGCTCTATCTACAGAA
AGTGGTGGTCTGACAGAATTCGTTCCTACTCTTTCACGAGCTGCTTTAGC
TGCAGGAGCTCATGGCCTTTTTATAGAGACCCATACCAATCCAAAAATCG
CTAAAAGTGATGCAGCTTCTATGTTGAGCTTAGAAGAATTCGCAGCTCTC
CTCCCCACCTGGGATCAATTATTTACTTGCGTCAGTTCCTTTGATATGGT
CTCAGCATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy