Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_3 IGR570 IGR575 IGR576 IGR577 IGR571 IGR573 IGR572 IGR574 CPn0725 CPn0724 CPn0726 CPn0720 CPn0717 CPn0718 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 gyrA, - CPn0716 gyrB, - CPn0715 CPn0725 CPn0724 CPn0726 CPn0720 CPn0717 CPn0718 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 gyrA, - CPn0716 gyrB, - CPn0715 CPn0724 CPn0726 CPn0725 CPn0720 CPn0718 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 gyrA, - CPn0716 gyrB, - CPn0715 CPn0722 CPn0722 CPn0717
* Calculated from Protein Sequence

Gene ID: CPn0720

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
807003

Gene Stop:
807239

Gene Length:
237

Molecular Weight*:
8875

pI*:
10.20

Net Charge*:
3.23

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0720 is orthologously related to CT659: residues 1-78 of CPn0720 are 87% similar to residues 1-78 of CT659, a predicted conserved hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 9 clades of COG1837
COG name: Uncharacterized BCR
Functional Class:  S
The phylogenetic pattern of COG1837 is -----qvc-br-uj--olIN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
Slightly paralogous to CPn0906: residues 1-76 of CPn0720 are 46% similar to residues 1-78 of CT763, a predicted conserved hypothetical protein from C. trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MKEFLAYIIKNLVDRPEEVRIKEVQGTHTIIYELSVAKPDIGKIIGKEGR
TIKAIRTLLVSVASRNNVRVSLEIMEEK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGAATTTTTAGCCTATATCATTAAGAATCTAGTGGACCGCCCTGA
AGAAGTCCGTATTAAAGAAGTTCAGGGGACTCACACGATTATTTATGAAC
TAAGTGTAGCTAAACCTGATATCGGGAAGATCATTGGCAAAGAAGGCCGT
ACGATCAAAGCGATTCGTACTCTTCTGGTTTCTGTAGCAAGCAGGAACAA
TGTAAGGGTCAGTTTAGAAATTATGGAAGAAAAGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy