Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_3 IGR570 IGR575 IGR576 IGR577 IGR571 IGR573 IGR572 IGR574 IGR569 CPn0725 CPn0724 CPn0726 CPn0720 CPn0717 CPn0718 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 gyrA, - CPn0716 gyrB, - CPn0715 CPn0725 CPn0724 CPn0726 CPn0720 CPn0717 CPn0718 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 gyrA, - CPn0716 gyrB, - CPn0715 CPn0724 CPn0726 CPn0725 CPn0720 CPn0718 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 gyrA, - CPn0716 gyrB, - CPn0715 CPn0722 CPn0722 CPn0717
* Calculated from Protein Sequence

Gene ID: CPn0719

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
sfhB  

Definition:
pseudouridine synthase

Gene Start:
805916

Gene Stop:
806893

Gene Length:
978

Molecular Weight*:
36903

pI*:
9.50

Net Charge*:
10.87

EC:
4.2.1.70  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides  

Pathway: pathway table
Pyrimidine metabolism

Comment:
In E.coli, this protein is thought to belong to the YABO/YCEC/SFHB family (sfhB) and
play a role as a suppressor of the temperature-sensitivity of the FTSH1(TS) mutation.

Blast Summary:  PSI-Blast Search
CPn0719 is orthologously related to CT658: residues 4-314 of CPn0719 are 66% similar to residues 10-324 of CT658, a predicted ribosomal large subunit Pseudouridine synthases D (pseudouridylate synthase) (uracil hydrolyase) from C. trachomatis.
CPn0719 is also similar to UU313, TP0339, MG209, MG370, CT106, UU113, TP0231.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0564
COG name: Predicted pseudouridylate synthase family 2
Functional Class: J
The phylogenetic pattern of COG0564 is ----YqVCEBRHUJGPOLINX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 15 to 62 (E-value = 4.2e-10) place CPn0719 in the S4 family which is described as S4 domain (PF01479)
Residues 90 to 245 (E-value = 3.4e-71) place CPn0719 in the PseudoU_synth_2 family which is described as RNA pseudouridylate synthase (PF00849)

PDB Hit:


Gene Protein Sequence:
MKTVTSFTVCKENSGRLDKYLTEVHPKYSRAFYQEHILSGLVQINGQINT
RVATRLNCGDIVTIDIQEKEELLELLPEAIPLDKVYEDGMILVINKPRDM
VVHPAPGHFHGTLVHALLHEIGERLKEEFPEEPWRPGIVHRLDKDTSGLI
ITAKTRQAKKVFSELFSTKRLKKSYLAVCIGKPRSTTIHTHISRHQNKRK
EMTVSSQGKEAVTHCQVLAFNGKLSFVALSPETGRTHQLRVHMKHLGTPI
LGDPVYGIPSMNSSYGLDKQQLHAYSVDFTHPETRQFCSLKAGLPEDMRS
LLIKEFRNETTILNKNLLESILKEQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAACTGTGACTTCCTTTACTGTATGTAAAGAAAACTCGGGGCGTTT
AGACAAGTACCTGACTGAGGTGCATCCCAAATATTCTCGAGCTTTCTACC
AAGAACATATCTTAAGTGGTCTTGTCCAAATCAATGGGCAAATAAACACC
AGGGTGGCAACGCGCTTAAATTGTGGTGATATAGTCACTATAGATATCCA
AGAAAAGGAAGAACTTCTTGAGCTCCTACCCGAAGCCATCCCTCTAGATA
AGGTTTATGAGGATGGAATGATCTTAGTGATCAATAAACCTCGGGATATG
GTGGTCCATCCAGCACCTGGTCATTTCCATGGAACCCTGGTTCATGCTCT
TCTCCATGAAATAGGAGAGAGACTGAAGGAAGAATTCCCTGAGGAACCTT
GGAGACCTGGAATCGTACATCGACTTGATAAAGATACCTCGGGATTGATT
ATTACTGCAAAAACGCGGCAGGCCAAGAAGGTTTTCAGCGAGCTTTTTTC
AACCAAGCGGTTAAAGAAAAGCTACTTAGCAGTTTGTATAGGGAAACCTA
GGAGTACTACGATCCATACACATATAAGCCGGCATCAAAACAAACGTAAA
GAAATGACTGTAAGCTCTCAAGGAAAAGAAGCCGTTACCCACTGCCAAGT
CCTTGCTTTTAATGGAAAACTGAGTTTTGTTGCCTTGTCTCCAGAGACAG
GAAGGACCCACCAGCTTAGGGTTCATATGAAACATTTAGGGACTCCTATT
CTTGGGGATCCTGTGTATGGAATCCCCTCTATGAATTCGAGTTACGGTCT
TGATAAACAACAATTGCATGCCTATAGCGTTGATTTCACTCATCCAGAAA
CCCGGCAATTTTGTTCATTAAAGGCGGGTTTACCCGAGGATATGCGTTCC
CTCTTAATAAAAGAATTCCGCAATGAAACAACTATATTAAATAAAAATTT
ATTGGAATCGATTTTAAAAGAACAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy