Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_3 IGR570 IGR575 IGR571 IGR573 IGR572 IGR574 IGR569 CPn0724 hemA, - CPn0714 CPn0720 CPn0717 CPn0718 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 gyrA, - CPn0716 gyrB, - CPn0715 CPn0724 hemA, - CPn0714 CPn0720 CPn0717 CPn0718 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 gyrA, - CPn0716 gyrB, - CPn0715 CPn0724 hemA, - CPn0714 CPn0720 CPn0718 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 gyrA, - CPn0716 gyrB, - CPn0715 CPn0722 CPn0722 CPn0717
* Calculated from Protein Sequence

Gene ID: CPn0718

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
805309

Gene Stop:
805629

Gene Length:
321

Molecular Weight*:
12283

pI*:
7.20

Net Charge*:
0.27

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
None.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MSFTYFLALPVDRLMQERFLCSPKRWAPFINSPLYLTLIADHDTPYLAKN
LDKFPLPVEQWEKTVLHVSSLLKSIFLCSDLSSLRLLACTKFEILTLNDL
YCAQNI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCGTTTACCTATTTCCTAGCGCTTCCCGTAGATAGGCTTATGCAAGA
ACGGTTCCTCTGTTCTCCCAAACGTTGGGCTCCTTTTATCAATTCGCCTT
TATACCTTACTCTCATTGCTGACCACGATACTCCTTATTTGGCTAAGAAT
CTTGATAAGTTTCCCTTACCTGTAGAGCAATGGGAAAAAACGGTCCTGCA
CGTCTCTAGCCTATTGAAGTCTATATTTTTATGTTCAGACCTTTCCTCTT
TAAGGTTGCTGGCCTGTACAAAATTCGAAATCTTGACTTTGAACGACCTT
TATTGCGCCCAAAATATCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy