Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_3 IGR570 IGR575 IGR567 IGR571 IGR573 IGR572 IGR568 IGR574 IGR569 CPn0713 hemA, - CPn0714 CPn0712 CPn0720 CPn0717 CPn0718 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 gyrA, - CPn0716 gyrB, - CPn0715 CPn0713 hemA, - CPn0714 CPn0712 CPn0720 CPn0717 CPn0718 yhbG, - CPn0723 kdsA, - CPn0721 sfhB, - CPn0719 gyrA, - CPn0716 gyrB, - CPn0715 hemA, - CPn0714 CPn0712 CPn0713 CPn0720 CPn0718 kdsA, - CPn0721 sfhB, - CPn0719 gyrA, - CPn0716 gyrB, - CPn0715 CPn0722 yhbG, - CPn0723 CPn0717 CPn0722
* Calculated from Protein Sequence

Gene ID: CPn0716

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gyrA  

Definition:
DNA gyrase subunit A (topoisomerase)

Gene Start:
803469

Gene Stop:
804905

Gene Length:
1437

Molecular Weight*:
53888

pI*:
7.50

Net Charge*:
3.85

EC:
 

Functional Class:
DNA metabolism  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0716 is similar to MG004 abd MG204 in M. genitalium, TP0005 in T. pallidum and UU082 and UU467 in U. urealyticum. They are all predicted DNA gyrase subunit A.

CPn0716 is orthologously related to CT660: residues 1-469 are 72% similar to that of CT660. CPn0716 is also similar to CT189, also a predicted DNA gyrase subunit A.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0188
COG name: DNA gyrase (topoisomerase II) A subunit
Functional Class:  L
The phylogenetic pattern of COG0188 is a---yqvCEBrHujGPOlINX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0274 is paralogously related to CPn0274, a predicted DNA gyrase subunit A: residues 2-313 are 32% similar to residues 1-351 of CPn0274.

Pfam Summary:  Pfam Search
Residues 23 to 452 (E-value = 1.5e-42) place CPn0716 in the DNA_topoisoIV family which is described as DNA gyrase/topoisomerase IV, subunit A (PF00521)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
303  
381

PDB Hit:


Gene Protein Sequence:
MRDVSELFRTHFMHYASYVILERAIPHILDGLKPVQRRLLWTLFLMDDGK
MHKVANIAGRTMALHPHGDAPIVEALVVLANKGYLIDTQGNFGNPLTGDP
HAAARYIEARLSPLARETLFNTDLIAFHDSYDGREKEPDILPAKLPVLLL
HGVDGIAVGMTTKIFPHNFAELLKAQIAILNDKKFTVFPDFPSGGLMDPS
EYQDGLGSITLRASIDIINDKTLVVKQICPQSTTETLIRSIENAAKRGTI
KIDTIQDFSTDVPHIEIKLPKGSRAKEMLPLLFEHTECQVILYSKPTVIY
ENKPVECSISEILKLHTTALQGYLEKELLLLQEQLTLDHYHKTLEYIFIK
HKLYDSVREVLAINKKISADDLHQAVLHALEPWLHELATPVTKQDTSQLA
SLTIKKILCFNEEACTKELLAIEKKQAAIQKDLGRIKEVTVKYLKGLLER
HGHLGERKTQITNFKTAKTSILKQQTLI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGTGACGTTTCAGAGCTTTTTCGAACACATTTTATGCATTACGCGTC
TTACGTAATTTTAGAGAGAGCGATTCCTCATATTCTTGATGGCTTAAAAC
CGGTGCAGCGTCGACTTCTATGGACTTTATTCCTTATGGACGACGGGAAA
ATGCATAAAGTTGCCAATATTGCAGGAAGAACTATGGCTCTCCATCCCCA
TGGCGATGCCCCTATTGTTGAAGCTCTTGTTGTCTTAGCAAATAAAGGCT
ACCTCATCGACACGCAAGGAAACTTCGGAAATCCCCTTACGGGAGATCCT
CACGCTGCTGCCCGTTATATAGAAGCACGACTCAGTCCTTTAGCTCGAGA
AACGCTCTTTAATACCGACTTGATAGCTTTTCATGACTCTTATGATGGAA
GAGAAAAAGAACCTGATATTTTACCTGCAAAGCTCCCCGTGCTTTTACTT
CATGGTGTGGACGGGATTGCTGTGGGGATGACCACGAAAATTTTCCCTCA
CAATTTTGCAGAACTTTTGAAAGCGCAAATTGCAATTTTAAATGATAAAA
AATTCACTGTGTTTCCTGACTTTCCTTCGGGAGGATTGATGGATCCCTCG
GAGTATCAAGATGGATTGGGATCGATTACACTGCGTGCATCTATAGACAT
TATTAATGATAAAACGCTTGTAGTGAAACAAATTTGTCCTCAATCTACGA
CTGAGACTTTGATCCGTTCTATAGAGAACGCAGCAAAACGTGGCACAATT
AAAATCGATACCATCCAAGACTTCTCTACAGATGTCCCTCACATTGAAAT
TAAGCTGCCAAAAGGCTCTCGAGCCAAAGAGATGCTTCCCTTGTTATTCG
AGCATACTGAATGCCAGGTGATTCTCTATTCTAAGCCCACAGTCATTTAC
GAGAATAAGCCTGTAGAATGTTCGATATCCGAGATTCTCAAACTGCATAC
TACAGCTCTACAGGGGTATCTTGAAAAAGAACTTTTGTTGCTCCAAGAAC
AACTTACTTTGGACCATTATCATAAAACCTTAGAATACATCTTTATTAAA
CATAAGCTCTATGATTCTGTCCGAGAAGTCCTAGCCATAAACAAGAAAAT
TTCTGCTGATGACCTACATCAAGCAGTGCTCCATGCTCTGGAGCCCTGGC
TTCATGAGCTTGCAACTCCCGTTACAAAACAAGACACCTCTCAACTTGCT
TCACTAACGATTAAGAAAATCCTTTGCTTTAATGAAGAGGCATGCACTAA
GGAACTGCTAGCCATAGAAAAAAAACAAGCAGCGATACAAAAAGATCTTG
GAAGAATAAAAGAAGTCACCGTCAAGTACCTCAAAGGACTTTTAGAACGC
CATGGACACTTAGGAGAGAGAAAAACACAGATCACAAACTTTAAGACGGC
AAAGACATCTATCTTGAAACAACAAACCTTAATTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy