Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_3 IGR570 IGR567 IGR571 IGR573 IGR572 IGR568 IGR574 IGR569 CPn0713 hemA, - CPn0714 CPn0712 CPn0720 CPn0717 CPn0718 sfhB, - CPn0719 gyrA, - CPn0716 gyrB, - CPn0715 CPn0713 hemA, - CPn0714 CPn0712 CPn0720 CPn0717 CPn0718 sfhB, - CPn0719 gyrA, - CPn0716 gyrB, - CPn0715 Type: tandem, Name:  - 11 CPn0713 hemA, - CPn0714 CPn0712 CPn0720 CPn0718 sfhB, - CPn0719 gyrA, - CPn0716 gyrB, - CPn0715 CPn0717
* Calculated from Protein Sequence

Gene ID: CPn0715

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gyrB  

Definition:
DNA gyrase subunit B (topoisomerase)

Gene Start:
801657

Gene Stop:
803465

Gene Length:
1809

Molecular Weight*:
68249

pI*:
9.50

Net Charge*:
10.52

EC:
5.99.1.3  

Functional Class:
DNA metabolism  

Pathway: pathway table

Comment:
From Prosite PDOC00160:

DNA topoisomerase I (EC 5.99.1.2) is one of the
two types of enzyme that catalyze the
interconversion of topological DNA isomers. Type
II topoisomerases are ATP-dependent and act by
passing a DNA segment through a transient
double-strand break. Topoisomerase II is found
in phages, archaebacteria, prokaryotes,
eukaryotes, and in African Swine Fever virus
(ASF). In bacteriophage T4 topoisomerase II
consists of three subunits (the product of genes
39, 52 and 60). In prokaryotes and in
archaebacteria the enzyme, known as DNA gyrase,
consists of two subunits (genes gyrA and gyrB).
In some bacteria, a second type II topoisomerase
has been identified; it is known as
topoisomerase IV and is required for chromosome
segregation, it also consists of two subunits
(genes parC and parE). In eukaryotes, type II
topoisomerase is a homodimer.

Blast Summary:  PSI-Blast Search
CPn0715 is similar to UU466 and UU081 in U. urealyticum, MG003 and MG203 in M. genitalium and TP1006 in T. pallidum.

CPn0715 is orthologously related to CT661:
residues 3-601 are 71% similar to residues 6-604
of CT661. CPn0715 is also similar to CT190, also
predicted DNA gyrase subunit B.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0187
COG name: DNA gyrase (topoisomerase II) B subunit
Functional Class:  L
The phylogenetic pattern of COG0187 is a---yqvCEBrHujGPOlINX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0715 is paralogously related to CPn0275, a
predicted DNA gyrase subunit B: residues 4-538
are 30% similar to residues 8-579.

Pfam Summary:  Pfam Search
Residues 34 to 167 (E-value = 5.8e-11) place CPn0715 in the HATPase_c family which is described as Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase (PF02518)
Residues 207 to 362 (E-value = 1.4e-16) place CPn0715 in the DNA_gyraseB family which is described as DNA gyrase B (PF00204)

PDB Hit:


Gene Protein Sequence:
MAAYTEASILSLASLDHIRLRAGMYIGRLGNGSQKEDGIYTLFKEVVDNG
IDEFIMGHGKSLKISASDKQISIQDQGRGIPLGKLIDCVSKINTGAKYTQ
DVFHFSVGLNGVGLKAVNALSEIFSVRSVRKKKYHLATFHRGVLQESKQG
STKDPDGTFVSFTPDPSIFPEFTFNHDFLKDKIRQYTYLHSGLEIRFNDE
VFISHNGLKDLFDAEITEPPLYSPLFFQNEDLTFIFSHLEGNTERYFSFV
NGQETLDGGTHLTAFKEAIVKGVNEFFGKTFVSNDIREGIVGCIAIKIAS
PIFESQTKNKLGNTQIRSSLIKDVKEAIVQALRKDKVAPELLLEKIKFNE
KTRKNIQFIKQDLKSKQKKVHYKIPKLRDCKFHYNDRSLYGEASSIFLTE
GESASASILASRNPLTQAVFSLRGKPMNVFSLEETKMYKNDELFYLATAL
GITQNEIQHLRYNKVILATDADVDGMHIRNLLITFFLKTLLPLVENNHLF
ILETPLFKVRNKTTTLYYYSEQEKMQALQQFGKKDSSLEITRFKGLGEIS
PKEFAAFIGPEIRLTPVTITSLESISSILQFYMGKNTKERKQFIMDNLIT
DF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCGGCATACACAGAAGCAAGCATTCTTTCTTTGGCCTCTCTTGATCA
CATTCGTCTTCGGGCGGGGATGTACATTGGAAGGCTTGGCAATGGTTCTC
AAAAAGAGGATGGGATTTACACTCTTTTTAAAGAAGTGGTTGATAATGGG
ATTGATGAATTTATCATGGGTCATGGTAAATCTTTAAAAATTTCTGCTAG
TGACAAGCAGATCTCCATTCAAGATCAAGGTCGTGGCATTCCTTTAGGTA
AACTTATAGATTGTGTTTCTAAAATCAATACGGGAGCTAAATATACCCAA
GATGTTTTCCATTTCTCTGTAGGGCTGAATGGCGTGGGACTCAAAGCTGT
GAATGCACTTTCAGAAATATTTTCTGTACGTTCTGTAAGAAAGAAAAAAT
ACCACCTTGCCACCTTCCATCGAGGAGTTCTGCAAGAGTCTAAGCAAGGT
TCTACCAAAGATCCTGATGGAACTTTTGTTTCCTTTACTCCTGATCCTAG
TATCTTCCCTGAGTTTACTTTTAACCACGACTTCCTAAAAGATAAAATCC
GCCAATACACCTACCTACATTCGGGATTAGAGATCCGATTTAATGATGAG
GTGTTCATATCTCACAACGGTCTCAAAGATCTTTTCGATGCAGAGATCAC
TGAGCCCCCTTTATACTCTCCTCTTTTTTTTCAAAATGAGGATTTAACTT
TTATCTTTTCTCACCTTGAAGGAAATACGGAGCGTTATTTTTCTTTTGTC
AATGGACAAGAGACTCTTGACGGAGGAACACACCTGACTGCCTTTAAGGA
AGCCATAGTAAAAGGGGTCAACGAGTTTTTTGGAAAAACATTTGTTTCCA
ATGACATTCGAGAAGGCATTGTGGGCTGCATAGCAATAAAAATAGCCTCG
CCAATTTTTGAATCGCAAACGAAAAATAAGCTTGGGAATACACAGATTCG
GTCTTCTTTAATTAAAGATGTAAAGGAAGCGATTGTACAGGCCCTACGTA
AAGATAAAGTGGCTCCTGAGCTTCTTTTAGAAAAAATAAAATTCAATGAG
AAAACTCGAAAGAATATCCAATTTATAAAACAAGATCTTAAGAGCAAACA
GAAGAAAGTCCATTATAAAATTCCCAAACTTCGGGACTGTAAATTCCATT
ATAACGATCGCTCTCTGTATGGTGAGGCCTCTTCGATTTTCCTTACCGAA
GGGGAGTCTGCGTCCGCATCAATTCTTGCTTCAAGAAATCCCCTCACACA
AGCTGTCTTTTCACTTCGAGGAAAGCCTATGAATGTCTTTTCCTTAGAAG
AAACCAAAATGTATAAAAATGATGAGTTATTTTATTTAGCAACTGCTCTA
GGCATCACGCAAAACGAGATTCAGCATTTACGTTATAACAAAGTCATCCT
GGCTACTGATGCGGATGTAGACGGTATGCATATTCGTAATCTTTTGATTA
CTTTCTTCCTTAAAACACTCTTGCCTCTTGTAGAAAATAATCACCTCTTT
ATCTTAGAAACCCCTTTGTTTAAAGTTAGAAACAAAACGACTACGCTCTA
CTACTATTCTGAGCAAGAAAAGATGCAGGCGTTACAGCAATTTGGGAAAA
AGGACTCCTCTTTAGAAATCACAAGGTTTAAAGGTTTAGGAGAAATTTCT
CCTAAGGAATTTGCTGCGTTTATAGGTCCTGAGATCCGCCTCACCCCAGT
TACGATTACCTCTTTAGAGAGCATTTCTTCGATCTTACAATTCTATATGG
GGAAAAATACAAAAGAGAGAAAACAATTTATTATGGATAACCTTATTACT
GATTTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy