Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR570 IGR567 IGR564 IGR565 IGR563 IGR566 IGR571 IGR568 IGR569 CPn0711 CPn0710 CPn0713 CPn0709 CPn0708 hemA, - CPn0714 CPn0712 CPn0717 CPn0718 gyrA, - CPn0716 gyrB, - CPn0715 CPn0711 CPn0710 CPn0713 CPn0709 CPn0708 hemA, - CPn0714 CPn0712 CPn0717 CPn0718 gyrA, - CPn0716 gyrB, - CPn0715 Type: tandem, Name:  - 11 CPn0713 CPn0708 hemA, - CPn0714 CPn0712 CPn0709 CPn0710 CPn0711 CPn0718 gyrA, - CPn0716 gyrB, - CPn0715 CPn0717
* Calculated from Protein Sequence

Gene ID: CPn0714

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hemA  

Definition:
glutamyl-tRNA reductase

Gene Start:
801107

Gene Stop:
800088

Gene Length:
1020

Molecular Weight*:
39090

pI*:
9.70

Net Charge*:
11.61

EC:
1.2.1.-  

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; heme, porphyrin and cobalamin  

Pathway: pathway table
Phenylalanine metabolism
Porphyrin and chlorophyll metabolism
Tryptophan metabolism
Xenobiotics metabolism

Comment:
This protein is thought to play a role in first step in porphyrin
biosynthesis by the C5 pathway.

Blast Summary:  PSI-Blast Search
CPn0714 is orthologous to CT662, a predicted glutamyl-tRNA reductase:
residues 3-303 are 45% similar to CT662. No similarity to T.pallidum,
M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0373
COG name: Glutamyl-tRNA reductase
Functional Class:  H
The phylogenetic pattern of COG0373 is amt--q-cebr-uj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search


Pfam Summary:  Pfam Search
Residues 6 to 150 (E-value = 1.3e-53) place CPn0714 in the GlutR_N family which is described as Glutamyl-tRNAGlu reductase, N-terminal domain (PF05201)
Residues 154 to 295 (E-value = 3.5e-26) place CPn0714 in the GlutR_NAD_bind family which is described as Glutamyl-tRNAGlu reductase, NAD(P) binding domain (PF05200)

PDB Hit:


Gene Protein Sequence:
MVLGVVGISYREAALKERERAIQYLQSFEKNLFLAQRFLGKGGAFIPLLT
CHRAELYYYSESPEIAQAALLSELTSQGIRPYRHRGLSCFTHLFQVTSGI
DSLIFGETEIQGQVKRAYLKGSKERELPFDLHFLFQKALKEGKEYRSRIG
FPDHQVTIESVVQEILLSYDKSIYTNFLFVGYSDINRKVAAYLYQHGYHR
ITFCSRQQVTAPYRTLSRETLSFRQPYDVIFFGSSESASQFSDLSCESLA
SIPKRIVFDFNVPRTFLWKETPTGFVYLDIDFISECVQKRLQCTKEGVNK
AKLLLTCAAKKQWEIYEKKSSHITQRQISSPRIPSVLSY$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTGTTAGGAGTTGTTGGAATCAGTTATCGTGAAGCCGCTTTGAAAGA
AAGAGAGCGTGCGATTCAATATCTGCAATCTTTTGAAAAAAATCTTTTCC
TTGCACAGCGTTTTTTAGGCAAAGGAGGAGCGTTTATCCCGTTACTTACT
TGTCATCGAGCCGAACTTTATTATTATTCAGAAAGTCCTGAAATTGCTCA
AGCCGCCTTACTTTCAGAATTGACATCCCAGGGAATACGTCCTTACCGTC
ATAGAGGTTTGTCTTGTTTTACTCATCTGTTTCAGGTCACCAGTGGTATA
GATAGTTTGATCTTTGGGGAAACGGAAATTCAAGGACAGGTAAAACGAGC
CTATTTAAAAGGAAGCAAAGAGAGAGAGTTGCCTTTTGATCTTCATTTTT
TATTTCAAAAAGCTCTAAAGGAAGGGAAGGAGTATCGCTCACGCATCGGG
TTTCCCGATCATCAAGTGACCATAGAATCTGTCGTTCAAGAAATTCTACT
CAGCTACGACAAGTCGATATATACGAATTTTTTATTCGTAGGATACTCGG
ATATCAATAGGAAAGTCGCTGCCTACTTATATCAACATGGGTATCATAGG
ATTACCTTTTGCTCTAGACAACAAGTCACGGCCCCCTATAGAACCTTGTC
TCGAGAAACGCTCTCATTTCGACAACCCTATGATGTGATTTTCTTTGGCT
CTTCAGAATCAGCTTCACAATTTTCCGATCTTTCCTGTGAGAGTCTTGCT
AGCATTCCCAAACGTATTGTCTTTGATTTTAACGTGCCACGAACCTTTTT
ATGGAAAGAAACCCCTACAGGTTTTGTTTATTTAGATATAGATTTCATCA
GTGAATGCGTGCAAAAAAGACTGCAATGCACCAAAGAAGGAGTAAATAAA
GCAAAACTTTTGTTAACTTGTGCCGCGAAAAAACAATGGGAAATTTATGA
AAAAAAGAGCTCACATATAACCCAGAGGCAAATTTCATCCCCACGTATTC
CTTCCGTTCTAAGCTATTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy