Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR562 IGR560 IGR567 IGR561 IGR564 IGR565 IGR563 IGR566 IGR568 IGR569 CPn0711 CPn0710 CPn0713 CPn0709 CPn0706 CPn0708 CPn0705 hemA, - CPn0714 sctN,yscN, - CPn0707 CPn0712 gyrB, - CPn0715 CPn0711 CPn0710 CPn0713 CPn0709 CPn0706 CPn0708 CPn0705 hemA, - CPn0714 sctN,yscN, - CPn0707 CPn0712 gyrB, - CPn0715 Type: tandem, Name:  - 11 CPn0710 CPn0713 CPn0708 CPn0705 hemA, - CPn0714 sctN,yscN, - CPn0707 CPn0712 CPn0709 CPn0706 CPn0711 gyrB, - CPn0715
* Calculated from Protein Sequence

Gene ID: CPn0712

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (acidic, homology to adenylate cyclase)

Gene Start:
799315

Gene Stop:
796778

Gene Length:
2538

Molecular Weight*:
93150

pI*:
4.50

Net Charge*:
-55.58

EC:
 

Functional Class:
cellular processes; signal transduction  
unknown  

Pathway: pathway table

Comment:
See CT664.

Blast Summary:  PSI-Blast Search
Weak hits in gapped BLAST over first 300 residues; e.g. residues 26-302 are 23% similar to NFM_RAT; residues 120-270 are 22% similar to (U51555) nucleolar phosphoprotein [Tetrahymena thermophila]; and residues 91-279 are 19% similar to (AF094508) dentin phosphoryn [Homo sapiens].
Residues 1-845 are 55% similar to CT664, with stronger alignment over latter 2/3 of sequences. Residues 178-351 are 20% similar to TP0470. No significant similarity to M.genitalium, U.ureaplasma, or M.pneumoniae.

COGS Summary:  COGS Search
BeTs to 3 clades of COG1716
COG name: Uncharacterized BCR
Functional Class:  S
The phylogenetic pattern of COG1716 is -------c--R-------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 106-433 are 22% similar to a defined domain of Q99730_HUMAN, defined as: ELONGATION FACTOR TAT-SF1 HIV-1 TRANSCRIPTIONAL TAT COFACTOR.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 25 to 90 (E-value = 6.6e-12) place CPn0712 in the FHA family which is described as FHA domain (PF00498)
Residues 422 to 488 (E-value = 4.1e-12) place CPn0712 in the FHA family which is described as FHA domain (PF00498)
Residues 707 to 767 (E-value = 3.9e-15) place CPn0712 in the BON family which is described as Putative phospholipid-binding domain (PF04972)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
75  
168
coil-coil  
169  
199
non-globular  
200  
298
coil-coil  
299  
337
transmembrane  
548  
565

PDB Hit:


Gene Protein Sequence:
MAVRLIVDEGPLSGVIFVLEDGISWSIGRDSSANDIPIEDPKLGASQAII
NKTDGSYYITNLDDTIPIVVNGVAIQETTQLKNEDTILLGSNQYSFLSDE
FDPQDLVYDFDIPEENFSNDSGDLSDSNEQGKDLEPRQTSETNHSPKPKE
KLTKDQGSSDPITSGDQELADAFLASAKAEKNQPRAKVAKKGLKESSNES
LNPKEQNAKDSPKGEERTNKPQNAIMEDNGASPRQDPQPKSAEPSLKNTA
RDETPLKENKPVEEKANKKATPDSPEKKDQPEEGSKKEGSKIEATPLDSQ
KESEDKEAEEAFVQEEEENLTEDNKEDSDSAADANDDTASDHTAEDNKET
PKKVENEKSAVLSPFHVQDLFRFDQTIFPAEIDDIAKKNISVDLTQPSRF
LLKVLAGANIGAEFHLDSGKTYILGTDPTTCDIVFNDLSVSHQHAKITVG
NDGGILIEDLDSKNGVIVEGRKIDKTSTLSSNQVVALGTTLFLLIDHHAP
ADTIVASLSPDDYSLFGRQQDAEALERQEAQEEEEKQKRATLPAGSFILT
LFVGGLAILFGIGTASLFHTKEVVPLENIDYQEDLAQVINQFPTVRYTFN
KTNSQLFLIGHVKNSTDKSELLYKVDALSFVKSVDDNVIDDEAVWQEMNI
LLSKRPEFKGISMHSPEPGKFIITGYVKTEEQAACLVDYLNIHFNYLSLL
ENKVVVETQMLKAIAGHLLQGGFANIHVAFVNGEVILTGYVNNDDAEKFR
AVVQELSGIPGVRLVKNFAVLLPAEEGIIDLNLRYPNRYRVTGYSRYGEI
SINVVVNGRILTRGDVIDGMTVTSIQPNAIFLEKEGLKYKIDYNK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAGTACGATTAATTGTTGATGAAGGCCCCTTGTCTGGTGTAATTTT
TGTTCTGGAAGATGGGATAAGCTGGTCTATAGGACGCGACTCTAGTGCTA
ATGACATTCCTATTGAAGATCCTAAACTCGGTGCATCGCAAGCCATTATC
AATAAGACTGACGGAAGCTACTACATCACAAATTTAGATGATACAATTCC
TATTGTTGTAAATGGCGTAGCGATCCAAGAAACTACACAGTTAAAAAATG
AAGATACTATCTTATTAGGAAGCAATCAGTATTCTTTCTTATCAGATGAA
TTTGATCCTCAAGATCTTGTTTATGATTTTGATATTCCCGAAGAAAATTT
TTCTAATGATTCAGGGGATTTGTCCGATAGTAATGAACAGGGAAAAGATC
TTGAGCCTCGGCAAACTTCGGAAACAAATCATTCACCGAAGCCTAAGGAA
AAGCTGACCAAAGATCAGGGAAGTAGCGATCCAATTACAAGTGGGGATCA
GGAGCTTGCTGATGCTTTTTTAGCATCAGCAAAAGCGGAAAAAAATCAAC
CAAGAGCCAAAGTTGCTAAGAAGGGTTTAAAAGAATCTTCAAACGAGTCT
TTGAATCCAAAGGAACAAAATGCAAAGGATTCTCCGAAAGGAGAGGAAAG
AACCAACAAACCCCAGAACGCCATTATGGAAGATAACGGAGCTTCGCCTA
GGCAAGATCCGCAACCAAAGTCAGCAGAACCCTCTCTTAAAAACACAGCC
AGGGATGAGACTCCCTTGAAAGAAAATAAACCTGTAGAAGAGAAGGCTAA
TAAGAAAGCAACACCGGATTCTCCAGAAAAAAAAGATCAACCTGAGGAAG
GTTCTAAAAAGGAAGGCTCTAAAATAGAAGCAACACCTTTGGATTCACAA
AAAGAATCCGAGGATAAGGAAGCAGAAGAAGCCTTTGTACAAGAAGAAGA
AGAGAACCTTACGGAAGATAATAAAGAAGATTCTGACAGTGCCGCTGATG
CAAATGACGACACGGCAAGTGACCATACTGCAGAGGATAACAAAGAAACT
CCTAAAAAAGTCGAGAACGAAAAGAGCGCAGTTCTATCCCCATTTCATGT
TCAAGACTTATTTCGATTCGATCAAACAATTTTTCCAGCAGAGATTGATG
ATATTGCGAAAAAAAATATCTCTGTAGACTTGACGCAGCCTTCTCGTTTT
TTACTCAAAGTTTTAGCCGGAGCTAATATTGGAGCAGAGTTCCATTTAGA
CTCAGGAAAAACCTATATTTTAGGTACGGATCCTACAACTTGTGACATAG
TATTTAATGACTTAAGTGTTTCTCATCAACATGCTAAAATTACTGTCGGT
AATGACGGGGGCATTCTTATCGAGGATCTCGATAGTAAAAACGGTGTCAT
TGTTGAAGGACGAAAAATTGATAAGACCTCTACATTGAGCTCGAATCAAG
TTGTGGCTTTAGGAACGACATTATTTTTACTTATAGATCATCATGCCCCC
GCTGATACTATAGTTGCTTCTCTATCCCCAGACGATTACAGTTTGTTTGG
GAGACAGCAAGACGCCGAAGCCTTAGAAAGACAAGAGGCCCAAGAAGAAG
AAGAAAAACAAAAACGCGCTACACTACCCGCAGGATCTTTCATTCTTACC
CTGTTTGTTGGAGGATTGGCTATTCTCTTTGGTATAGGAACAGCTTCTCT
TTTCCATACCAAAGAAGTGGTTCCTTTAGAAAATATTGATTATCAAGAAG
ATCTTGCCCAGGTTATCAATCAGTTCCCTACGGTGCGTTATACGTTTAAT
AAAACGAACAGCCAACTTTTCTTAATCGGACATGTCAAAAATAGTACGGA
CAAAAGCGAGCTGCTGTATAAAGTAGACGCCCTTTCCTTTGTGAAATCCG
TAGATGATAATGTTATTGATGATGAAGCTGTTTGGCAGGAGATGAACATC
CTGTTATCAAAGCGACCCGAGTTTAAAGGCATCAGCATGCATTCCCCAGA
ACCTGGGAAATTCATCATCACAGGCTATGTCAAGACTGAGGAGCAAGCAG
CTTGCCTCGTTGATTATTTAAATATACATTTTAATTACCTCTCGTTACTA
GAGAATAAAGTTGTTGTTGAAACCCAGATGTTAAAAGCAATTGCAGGCCA
TCTTCTTCAAGGAGGTTTTGCAAACATCCATGTGGCCTTTGTGAACGGTG
AAGTTATCCTTACTGGTTACGTCAATAACGATGATGCAGAGAAGTTCCGT
GCTGTAGTGCAAGAGCTGTCGGGGATTCCTGGTGTGAGGTTGGTCAAGAA
TTTTGCTGTCTTACTCCCAGCTGAAGAGGGAATCATAGATTTAAACCTAC
GTTACCCCAATCGCTATCGTGTTACAGGCTATTCTAGATACGGAGAAATA
AGTATCAATGTAGTTGTCAATGGCAGAATCCTCACAAGAGGGGACGTGAT
TGATGGTATGACAGTAACAAGTATACAACCTAACGCGATCTTTTTAGAGA
AGGAAGGGTTGAAATATAAAATAGACTACAATAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy