Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR562 IGR560 IGR559 IGR567 IGR561 IGR564 IGR565 IGR563 IGR566 IGR568 IGR569 CPn0711 CPn0710 CPn0713 CPn0709 CPn0706 CPn0708 CPn0705 hemA, - CPn0714 CPn0704 sctN,yscN, - CPn0707 CPn0712 CPn0711 CPn0710 CPn0713 CPn0709 CPn0706 CPn0708 CPn0705 hemA, - CPn0714 CPn0704 sctN,yscN, - CPn0707 CPn0712 Type: tandem, Name:  - 11 CPn0710 CPn0713 CPn0708 CPn0705 hemA, - CPn0714 CPn0704 sctN,yscN, - CPn0707 CPn0712 CPn0709 CPn0706 CPn0711
* Calculated from Protein Sequence

Gene ID: CPn0710

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
796461

Gene Stop:
796207

Gene Length:
255

Molecular Weight*:
9331

pI*:
4.90

Net Charge*:
-1.11

EC:
 

Functional Class:

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0710 is orthologously related to CT666: residues 6-84 of CPn0710 are 93% similar to residues 5-83 of CT666, a predicted Chlamydia-specific protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MATNKSCTAFDFNKMLDGVCTYVKGVQQYLTELETSTQGTVDLGTMFNLQ
FRMQILSQYMESVSNILTAVNTEMITMARAVKGS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTACAAATAAAAGTTGCACAGCATTCGATTTTAATAAGATGCTAGA
CGGCGTATGTACTTACGTGAAGGGTGTTCAACAGTATTTAACTGAGTTAG
AGACATCAACACAAGGCACTGTCGATTTGGGAACCATGTTTAATTTGCAA
TTCCGTATGCAGATCTTATCACAGTATATGGAATCGGTGTCCAACATCCT
AACCGCTGTGAACACAGAGATGATCACAATGGCTAGAGCAGTTAAAGGAA
GTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy