Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR562 IGR560 IGR559 IGR567 IGR558 IGR561 IGR564 IGR565 IGR563 IGR566 IGR568 CPn0711 CPn0710 CPn0713 CPn0709 CPn0706 CPn0708 CPn0705 hemA, - CPn0714 CPn0704 sctN,yscN, - CPn0707 pkn5, - CPn0703 CPn0712 CPn0711 CPn0710 CPn0713 CPn0709 CPn0706 CPn0708 CPn0705 hemA, - CPn0714 CPn0704 sctN,yscN, - CPn0707 pkn5, - CPn0703 CPn0712 Type: tandem, Name:  - 11 CPn0710 CPn0713 CPn0708 CPn0705 hemA, - CPn0714 CPn0704 sctN,yscN, - CPn0707 pkn5, - CPn0703 CPn0712 CPn0709 CPn0706 CPn0711
* Calculated from Protein Sequence

Gene ID: CPn0708

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
795705

Gene Stop:
795031

Gene Length:
675

Molecular Weight*:
24907

pI*:
4.20

Net Charge*:
-17.55

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0708 is orthologously related to CT668: residues 1-224 of CPn0708 are 63% similar to residues 1-223 of CT668, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MIDPVECFPNLDGDAEAQSITQNSGTPLASELKKDISPFALGSYAAPKDT
TLVQGFKPNPMAMMQDQNSNLIDPELQEALESEELQEQINNLKGRLWDFR
STFEDSQTTAQFADEHFQAVGVIIDLINEDLNTIAEHTQQDARKEDKEEG
SVTRKIIDWVSSGEEVLNRALLYFSDRDGNRESLANFLKVQYAVQRATQR
AELFASIVGTSVSSVKTIMTTQLG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATAGACCCTGTAGAATGTTTCCCCAACCTTGATGGAGATGCAGAAGC
GCAATCTATAACTCAGAATTCTGGCACCCCCTTAGCAAGTGAATTAAAAA
AAGATATTTCTCCATTTGCTTTGGGATCTTATGCTGCTCCTAAAGATACG
ACCCTTGTTCAAGGATTTAAACCAAATCCGATGGCAATGATGCAGGATCA
AAATTCTAATTTAATCGATCCTGAGTTGCAAGAGGCCTTGGAATCAGAAG
AGCTCCAAGAGCAAATTAACAACTTGAAAGGGCGCCTCTGGGATTTCCGC
TCAACTTTCGAAGATAGTCAGACAACAGCACAGTTTGCAGACGAGCATTT
CCAAGCTGTAGGAGTCATCATAGATTTAATTAACGAAGACTTGAATACGA
TTGCTGAGCACACACAACAAGATGCTCGGAAAGAAGATAAAGAAGAGGGT
TCGGTAACTAGGAAAATCATTGATTGGGTCTCCTCCGGAGAAGAGGTCCT
CAATCGTGCGTTGCTCTACTTCTCTGATAGAGATGGGAATCGTGAGAGTT
TAGCAAACTTCCTTAAAGTACAATATGCTGTGCAGCGAGCTACACAAAGA
GCAGAACTGTTTGCGAGTATTGTCGGTACCTCTGTAAGTAGCGTGAAAAC
GATTATGACAACGCAATTAGGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy