Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR562 IGR560 IGR559 IGR567 IGR558 IGR561 IGR564 IGR565 IGR563 IGR566 CPn0711 CPn0710 CPn0713 CPn0709 CPn0706 CPn0708 CPn0705 CPn0704 sctN,yscN, - CPn0707 CPn0712 yscC,sctC, - CPn0702 CPn0711 CPn0710 CPn0713 CPn0709 CPn0706 CPn0708 CPn0705 CPn0704 sctN,yscN, - CPn0707 CPn0712 yscC,sctC, - CPn0702 Type: tandem, Name:  - 11 CPn0710 CPn0713 CPn0708 CPn0705 CPn0704 sctN,yscN, - CPn0707 CPn0712 pkn5, - CPn0703 pkn5, - CPn0703 yscC,sctC, - CPn0702 CPn0709 CPn0706 CPn0711
* Calculated from Protein Sequence

Gene ID: CPn0707

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
sctN  yscN  

Definition:
flagellar-type ATPase (probable beta subunit)

Gene Start:
795029

Gene Stop:
793701

Gene Length:
1329

Molecular Weight*:
48095

pI*:
6.10

Net Charge*:
-3.61

EC:
3.6.1.34  

Functional Class:
cellular processes; secretion  

Pathway: pathway table
Energy Metabolism; Oxidative Phosphorylation
Membrane Transport; Type III Secretion System

Comment:
YopN translocation protein flagellar-type ATPase is a component of the Yop secretion machinery using ATP. YopN is either the energizer of this Yop translocation machinery or part of it.
YopN appears to be cytoplasmic but is probably connected to the inner membrane through LcrD (low calcium response protein D).

This protein may have a translocase function related to flagellar-specific
export. Other functions are possible.
See CT559, CT560, CT561, CT562, CT563 and CT564.

From Prosite PDOC00137:

ATP synthase (proton-translocating ATPase) (EC 3.6.1.34) is a component of
the cytoplasmic membrane of eubacteria, the inner membrane of
mitochondria, and the thylakoid membrane of chloroplasts. The ATPase
complex is composed of an oligomeric transmembrane sector, called CF(0),
and a catalytic core, called coupling factor CF(1). The former acts as a
proton channel; the latter is composed of five subunits, alpha, beta,
gamma, delta and epsilon. The sequences of subunits alpha and beta are
related and both contain a nucleotide-binding site for ATP and ADP. The
beta chain has catalytic activity, while the alpha chain is a regulatory
subunit.

Vacuolar ATPases (V-ATPases) are responsible for acidifying a variety of
intracellular compartments in eukaryotic cells. Like F-ATPases, they are
oligomeric complexes of a transmembrane and a catalytic sector. The
sequence of the largest subunit of the catalytic sector (70 Kd) is related
to that of F-ATPase beta subunit, while a 60 Kd subunit, from the same
sector, is related to the F-ATPases alpha subunit.

Archaebacterial membrane-associated ATPases are composed of three
subunits. The alpha chain is related to F-ATPases beta chain and the beta
chain is related to F-ATPases alpha chain.

A protein highly similar to F-ATPase beta subunits is found in some
bacterial apparatus involved in a specialized protein export pathway that
proceeds without signal peptide cleavage. This protein is known as fliI in
Bacillus and Salmonella, Spa47 (mxiB) in Shigella flexneri, HrpB6 in
Xanthomonas campestris and yscN in Yersinia virulence plasmids.

Blast Summary:  PSI-Blast Search
CPn0707 is orthologously related to CT669: residues 1-442 of CPn0707 are 92% similar to residues 1-442 of CT699, a predicted flagellar type ATPase (probable beta subunit) from C. trachomatis.
CPn0707 is also similar to TP0402, CT717. UU129, UU054, TP0528, MG399, MG401, UU132, CT307, TP0426, TP0529, TP0427, CT308, UU053, all predicted ATP synthase subunits.

COGS Summary:  COGS Search
BeTs to 8 clades of COG1157
COG name: Flagellar ATPase-like component
Functional Class:  C
The phylogenetic pattern of COG1157 is -----qv-eb--uj--olIN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0707 is paralogous to CPn0858, CPn0089, CPn0088. Residues 25-440 of CPn0707 are 36% similar to residues 21-430 of CPn0858, a predicted flagellum-specific ATP synthase from C. pneumoniae.
Residues 20-415 of CPn0707 are 26% similar to residues 1-378 of CPn0089, a predicted ATP synthase subunit B from C. pneumoniae.
Residues 146-377 of CPn0707 are 29% similar to residues 177-459 of CPn0088, a predicted ATP synthase subunit A from C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 27 to 91 (E-value = 5.1e-08) place CPn0707 in the ATP-synt_ab_N family which is described as ATP synthase alpha/beta family, beta-barrel domain (PF02874)
Residues 191 to 367 (E-value = 1.9e-102) place CPn0707 in the ATP-synt_ab family which is described as ATP synthase alpha/beta family, nucleotide-binding domain (PF00006)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
239

PDB Hit:


Gene Protein Sequence:
MDQLTTDFDTLMSQLGDVNLTTVVGRITEVVGMLIKAVVPNVRVGEVCLV
KRNGMEPLVTEVVGFTQSFAFLSPLGELSGVSPSSEVIPTGLPLHIRAGN
GLLGRVLNGLGEPIDVETKGPLQNVDQTFPIFRAPPDPLHRAKLRQILST
GVRCIDGMLTVARGQRIGIFAGAGVGKSSLLGMIARNAEEADVNVIALIG
ERGREVREFIEGDLGEEGMKRSVIVVSTSDQSSQLRLNAAYVGTAIAEYF
RDQGKTVVLMMDSVTRFARALREVGLAAGEPPARAGYTPSVFSTLPRLLE
RSGASDKGTITAFYTVLVAGDDMNEPVADEVKSILDGHIVLSNALAQAYH
YPAIDVLASISRLLTAIVPEEQRRIIGKAREVLAKYKANEMLIRIGEYRR
GSDREIDFAIDHIDKLNRFLKQDIHEKTNYEEAAQQLRAIFR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATCAGTTAACAACGGATTTCGACACTCTCATGTCACAACTTGGTGA
TGTGAATCTTACGACTGTAGTAGGCCGCATTACAGAAGTGGTCGGCATGT
TAATCAAAGCCGTAGTTCCTAATGTGCGTGTTGGAGAAGTATGCTTAGTG
AAACGTAACGGCATGGAACCTCTCGTAACAGAAGTCGTTGGTTTTACCCA
GAGTTTTGCCTTTCTCTCTCCTTTAGGAGAGTTATCAGGAGTGAGTCCTT
CTTCCGAAGTCATCCCTACAGGACTCCCCTTACACATTCGAGCAGGAAAC
GGCCTCTTAGGTCGTGTTCTCAATGGGTTGGGAGAACCCATAGATGTAGA
AACTAAAGGTCCATTACAAAATGTGGATCAAACATTTCCTATTTTTCGTG
CACCCCCAGATCCCCTGCATAGGGCGAAATTACGACAGATCCTGTCTACG
GGTGTGCGTTGTATAGACGGTATGCTCACGGTCGCTAGGGGGCAGCGTAT
TGGAATTTTTGCTGGTGCTGGAGTGGGAAAATCTTCGCTCTTAGGTATGA
TCGCAAGAAACGCTGAAGAAGCCGACGTTAATGTAATCGCGCTTATTGGA
GAAAGGGGGCGTGAAGTACGTGAGTTTATAGAGGGGGATTTGGGAGAAGA
AGGAATGAAACGTTCCGTAATTGTCGTTTCTACTTCTGACCAATCGTCGC
AATTGCGACTTAATGCCGCCTATGTAGGGACTGCAATTGCAGAGTATTTT
CGTGATCAAGGGAAAACTGTCGTACTTATGATGGATTCCGTGACACGATT
TGCTCGTGCATTGCGGGAAGTGGGGTTAGCCGCTGGAGAGCCTCCTGCTA
GAGCAGGATACACTCCATCGGTTTTTTCCACTCTACCCCGTCTATTGGAA
AGATCAGGAGCCTCCGATAAAGGAACCATTACAGCATTTTATACCGTCTT
GGTAGCAGGAGATGATATGAACGAGCCTGTTGCTGACGAAGTCAAATCGA
TTCTTGACGGGCATATTGTTCTCTCCAATGCACTAGCTCAAGCATACCAT
TATCCTGCAATTGACGTACTTGCTTCGATTAGCCGACTCCTGACTGCTAT
TGTTCCTGAAGAACAACGACGGATCATAGGGAAAGCAAGAGAAGTTTTAG
CTAAATATAAAGCCAACGAGATGTTGATCCGTATTGGAGAATACCGACGA
GGTTCTGATCGTGAGATAGATTTTGCTATCGACCATATTGACAAATTGAA
CCGGTTTTTAAAGCAAGATATCCACGAAAAGACAAACTATGAGGAAGCAG
CACAACAACTGCGCGCCATTTTCCGGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy