Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR562 IGR560 IGR559 IGR558 IGR561 IGR564 IGR565 IGR563 IGR566 CPn0711 CPn0710 CPn0709 CPn0706 CPn0708 CPn0705 CPn0704 sctN,yscN, - CPn0707 CPn0712 yscC,sctC, - CPn0702 CPn0711 CPn0710 CPn0709 CPn0706 CPn0708 CPn0705 CPn0704 sctN,yscN, - CPn0707 CPn0712 yscC,sctC, - CPn0702 CPn0710 CPn0708 CPn0705 CPn0704 sctN,yscN, - CPn0707 CPn0712 yscC,sctC, - CPn0702 pkn5, - CPn0703 pkn5, - CPn0703 CPn0709 CPn0706 CPn0711
* Calculated from Protein Sequence

Gene ID: CPn0705

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
793173

Gene Stop:
792331

Gene Length:
843

Molecular Weight*:
30937

pI*:
4.40

Net Charge*:
-20.04

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0705 is orthologously related to CT671: residues 1-280 of CPn0705 are 48% similar to residues 1-283 of CT671, a hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
97
transmembrane  
98  
116
transmembrane  
121  
138

PDB Hit:


Gene Protein Sequence:
MELKKTAESLYSAKTDNHTVYQNSPEPRDSRDVKVFSLEGKQTRQEKTTS
SKGNTRTESRKFADEEKRVDDEIAEVGSKEEEQESQEFCLAENAFAGMSL
IDIAAAGSAEAVVEVAPIAVSSIDTQWIENIILSTVESMVISEINGEQLV
ELVLDASSSVPEAFVGANLTLVQSGQDLSVKFSSFVDATQMAEAADLVTN
NPSQLSSLVSALKGHQLTLKEFSVGNLLVQLPKIEEVQTPLHMIASTIRH
REEKDQRDQNQKQKQDDKEQDSYKIEEARL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAATTAAAGAAAACAGCAGAATCATTATATAGCGCTAAAACAGACAA
TCACACTGTATACCAGAACTCTCCTGAACCTAGAGATAGTCGTGATGTAA
AAGTATTTTCTTTGGAAGGAAAGCAAACACGACAAGAGAAAACAACCTCA
AGTAAAGGAAATACACGTACAGAATCTAGAAAATTTGCTGATGAAGAGAA
GCGAGTTGATGATGAGATTGCTGAAGTAGGATCCAAAGAGGAAGAGCAAG
AATCTCAAGAATTTTGCCTTGCTGAGAACGCCTTTGCAGGTATGTCTCTT
ATAGATATCGCAGCAGCTGGATCAGCAGAAGCTGTTGTAGAAGTCGCTCC
CATAGCTGTTAGTAGTATCGATACACAGTGGATAGAAAATATCATACTTT
CTACTGTAGAATCTATGGTGATTTCAGAAATCAACGGTGAGCAACTTGTA
GAGTTGGTATTAGATGCTAGTTCTAGTGTGCCTGAAGCCTTTGTTGGAGC
TAATCTTACATTAGTGCAATCTGGACAGGATCTTTCCGTTAAGTTCTCAA
GTTTTGTAGATGCTACACAAATGGCAGAAGCTGCAGACCTTGTAACGAAT
AACCCTAGCCAACTTTCTTCATTGGTAAGTGCTTTAAAAGGTCATCAACT
CACATTAAAAGAATTCTCAGTTGGAAATCTTTTAGTACAGCTTCCTAAAA
TTGAAGAGGTACAAACTCCTCTACATATGATTGCATCTACGATCCGTCAT
AGAGAAGAGAAAGATCAAAGAGATCAGAATCAAAAACAAAAACAAGACGA
TAAAGAACAAGATTCTTATAAAATCGAAGAAGCACGTTTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy