Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Thr_3 IGR562 IGR560 IGR559 IGR558 IGR561 IGR564 IGR565 IGR563 IGR566 IGR557 CPn0711 CPn0710 CPn0709 CPn0706 CPn0708 CPn0705 CPn0704 sctN,yscN, - CPn0707 yscC,sctC, - CPn0702 CPn0711 CPn0710 CPn0709 CPn0706 CPn0708 CPn0705 CPn0704 sctN,yscN, - CPn0707 yscC,sctC, - CPn0702 CPn0710 CPn0708 CPn0705 CPn0704 sctN,yscN, - CPn0707 yscC,sctC, - CPn0702 pkn5, - CPn0703 pkn5, - CPn0703 CPn0709 CPn0706 CPn0711
* Calculated from Protein Sequence

Gene ID: CPn0704

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (acidic)(possible FLIN flagellar motor switch domain)

Gene Start:
792321

Gene Stop:
791206

Gene Length:
1116

Molecular Weight*:
41231

pI*:
4.60

Net Charge*:
-20.03

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
This protein shares a domain with flagellar motor switch protein FLIN and might belong to the FLIN/MOPA/SPAO family
(fliN), with function related to Type III secretion and standard secretion.

Blast Summary:  PSI-Blast Search
Numerous weak hits in gapped BLAST over last 100 residues of sequence to Flagellar Motor Switch Domain sequences; e.g. residues 1-371 are 52% similar to CT672; residues 309-371 are 26% similar to FLIN_ERWCA; residues 309-371 are 26% similar to FLIN_ECOLI; and residues 309-371 are 26% similar to FLIN_SALTY.
No significant similarity to M.genitalium, U.urealyticum, or T.pallidum.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1886
COG name: Flagellar motor switch protein FliN
Functional Class:  N
The phylogenetic pattern of COG1886 is -----q--eb--UJ--olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 309-371 are 26% similar to a defined domain of FLIN_ECOLI, defined as: PROTEIN FLAGELLAR SPAO FLAGELLA SWITCH FLIN MOTOR CHEMOTAXIS ROTATION MEMBRANE.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 300 to 371 (E-value = 6.8e-13) place CPn0704 in the SpoA family which is described as Surface presentation of antigens (SPOA) protein (PF01052)

PDB Hit:


Gene Protein Sequence:
MAVAADSSASWLKSRNNFLSSLGKTEEQVAAPEFPKELCQHKIREKFRLE
DVQVSIKFRGSITAVEATKEFGVHLLIQPMVVQPWEVENLLFLTSEEDLQ
ELMVAVFDDASLASYFYEKDKLLGFHYYFVAEACKLFEELQWVPSLSAKV
GGDAIFTATSLQGSFQVVDISLRLDGKNVRCRLLLPEDTFQSCQKFFSGL
HDESDLHNIDQTQQISLSVEVGYSQLTQEEWHQVVPGSFIMLDSCLYDPE
TEESGALLTVQKHQFFGGRFLTPSSGEFKITSYPNLTHEDPPLPENPQAS
AAPLPGYSRLVVEVARYSLAVSEFIKLNLGSILSLGNHPAYGVDIILDGA
KVGRGEIIALGDVLGIRVLEV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAGTAGCAGCCGATTCTAGTGCAAGTTGGCTAAAATCTCGGAATAA
TTTTTTAAGTTCCCTAGGGAAGACTGAGGAGCAGGTTGCTGCTCCTGAGT
TTCCTAAGGAACTGTGCCAACATAAAATTAGAGAGAAATTTCGACTTGAA
GATGTCCAGGTTTCTATAAAGTTTCGTGGATCTATAACTGCTGTAGAAGC
TACGAAAGAATTCGGCGTGCATCTTCTAATACAACCTATGGTAGTCCAAC
CTTGGGAAGTAGAAAATCTGTTGTTCCTAACATCAGAAGAAGACCTTCAG
GAGCTCATGGTAGCAGTATTTGATGATGCCAGCCTTGCTTCATATTTCTA
TGAAAAAGATAAGCTCCTAGGGTTCCATTATTATTTTGTCGCCGAAGCCT
GTAAATTATTTGAAGAGCTCCAGTGGGTGCCCTCTTTGTCTGCCAAAGTC
GGAGGGGATGCTATATTTACAGCTACAAGTCTGCAAGGCTCTTTCCAAGT
CGTAGATATTTCTCTGCGCCTAGATGGAAAAAATGTTCGATGTCGTCTGT
TATTGCCAGAAGATACCTTCCAAAGTTGTCAGAAGTTTTTCTCAGGTCTC
CATGATGAGTCGGATCTTCATAATATAGATCAAACGCAGCAGATCTCTCT
TTCTGTAGAAGTCGGGTATTCTCAGCTAACTCAAGAAGAATGGCATCAGG
TAGTCCCAGGATCATTCATTATGTTAGATAGCTGTCTTTATGATCCTGAA
ACCGAAGAAAGCGGCGCTTTACTCACAGTGCAAAAACATCAGTTTTTTGG
TGGCCGTTTCTTAACGCCCTCCTCTGGAGAATTTAAAATTACCAGTTACC
CTAACCTAACTCATGAAGACCCTCCTCTTCCTGAAAATCCACAAGCTTCC
GCAGCTCCCCTCCCTGGATACAGTAGACTCGTAGTCGAAGTTGCAAGATA
TTCCTTAGCAGTCAGTGAATTTATAAAATTGAACTTGGGAAGTATATTGA
GCTTGGGAAACCATCCAGCATACGGTGTGGATATCATTTTAGATGGAGCT
AAGGTCGGTAGGGGAGAAATTATCGCTCTAGGAGATGTTTTAGGTATTCG
CGTTTTAGAGGTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy