Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Thr_3 IGR562 IGR560 IGR559 IGR558 IGR561 IGR557 CPn0706 CPn0708 CPn0705 CPn0704 sctN,yscN, - CPn0707 yscC,sctC, - CPn0702 karG, - CPn0701 CPn0706 CPn0708 CPn0705 CPn0704 sctN,yscN, - CPn0707 yscC,sctC, - CPn0702 karG, - CPn0701 CPn0708 CPn0705 CPn0704 sctN,yscN, - CPn0707 yscC,sctC, - CPn0702 pkn5, - CPn0703 pkn5, - CPn0703 CPn0706 karG, - CPn0701 CPn0700 CPn0700
* Calculated from Protein Sequence

Gene ID: CPn0703

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pkn5  

Definition:
possible serine/threonine kinase

Gene Start:
791190

Gene Stop:
789682

Gene Length:
1509

Molecular Weight*:
57214

pI*:
7.60

Net Charge*:
4.42

EC:
2.7.-.-  

Functional Class:
protein fate; protein modification and repair  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Significant hits in gapped BLAST over the first 300 residues to serine/threonine protein kinase sequences; e.g. residues 17-279 are 28% similar to (AF035395) serine/threonine protein kinase [Pseudomonas aeruginosa]; residues 9-253 are 31% similar to (AL079308) putative serine/threonine protein kinase [Streptomyces coelicolor]; residues 7-268 are 27% similar to (Z95890) pknF [Mycobacterium tuberculosis]; residues 18-502 are 42% similar to CT673; residues 63-261 are 28% similar to CT301; residues 45-256 are 25% similar to MG109; and residues 91-211 are 34% similar to UU216. No significant similarity to T.pallidum.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0515
COG name: Serine/threonine protein kinases
Functional Class: T
The phylogenetic pattern of COG0515 is amtkYq-C-BR---gp-lIN-
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
Residues 130-160 and 195-210 represent blocks BL00107A-B (Protein kinases ATP-binding region proteins) with a combined E-value of 1.8e-17.

ProDom Summary:  Protein Domain Search
Residues 60-267 are 37% similar to a defined domain of O34507_BACSU, defined as: KINASE PROTEIN TRANSFERASE SERINE/THREONINE-PROTEIN ATP-BINDING RECEPTOR TYROSINE-PROTEIN PHOSPHORYLATION PRECURSOR CELL.

Paralogs:  Local Blast Search
Two possible paralogs exist: residues 63-456 are 22% similar to CPn0095; residues 15-216 are 18% similar to CPn0148.

Pfam Summary:  Pfam Search
Residues 18 to 253 (E-value = 1.8e-43) place CPn0703 in the Pkinase family which is described as Protein kinase domain (PF00069)

PDB Hit:


Gene Protein Sequence:
MDCRGGIPLPEPQVIGGYHVKKILSKKLRSRVVHGLHPETRHSTVIKVFS
PSPSFTSRSVYNFLKEAQSLHQITHPNIVKFHRYGKWQDCLYIAMEYIEG
ISLREYILAQFISLPQAIDIIFDIAQALEHLHSRNILHKDIKPENILITP
QGKIKLIDFGLADWDTEIQRAHPSVIGTPYYMSPEQRQGESHSPASDIYA
LGLLAYELILGHLSLGRVFLSLVPERISKILAKALQPSPNNRYSSTREFI
QDIHHYRMSGDMQEDLRIKDHTVALYEQLQTQRFWLAPETLRFPDFISGV
LYHQGYPLYPHAYDTLLEGDVFNLWLGYSPISNATIALSVVKSLVCQQDL
QRPLLDRVCEINECLIRMKIPIDEMGISILCLEISKENKELSWIACGKTV
FWIKRQGRVVQDFESFSPGLGKITSLQIRETKVAWEIGDEAVVCTLELEE
SVASLKTLSLAELQDRRQKAIFCPIESIHGGIQSRQHGSNSPSTLISLKR
IR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATTGTCGTGGTGGCATCCCTCTTCCTGAACCTCAGGTGATTGGCGG
ATATCATGTTAAAAAAATATTGAGTAAAAAATTAAGAAGTAGAGTTGTTC
ATGGTCTACATCCTGAAACACGCCATTCTACAGTCATAAAAGTTTTTTCT
CCTTCCCCCTCGTTCACGAGTCGCTCTGTCTATAATTTTCTTAAGGAAGC
ACAGAGCCTCCATCAAATTACTCATCCTAATATTGTTAAGTTCCATCGCT
ATGGCAAATGGCAAGATTGCCTCTACATTGCTATGGAGTATATAGAAGGG
ATCTCTTTAAGAGAGTATATCCTCGCGCAATTTATCTCTTTGCCACAAGC
CATAGATATTATCTTTGATATTGCTCAAGCTTTGGAGCACCTCCATAGTC
GGAATATTCTACATAAAGATATCAAGCCTGAAAATATTCTCATCACTCCT
CAGGGTAAAATCAAACTCATAGATTTCGGACTCGCTGATTGGGATACGGA
AATACAGAGAGCACATCCTAGCGTTATCGGAACTCCTTATTATATGAGTC
CAGAACAACGCCAAGGGGAGTCTCATTCTCCCGCTTCGGATATTTATGCT
TTAGGTTTGTTAGCTTATGAGTTGATCTTAGGGCACCTTTCTTTAGGACG
CGTCTTTCTTTCATTAGTGCCCGAAAGAATAAGTAAAATTTTAGCAAAAG
CGTTACAGCCTTCTCCTAATAATCGCTACAGCTCGACCCGAGAGTTTATC
CAGGATATACATCACTATCGCATGTCTGGAGACATGCAAGAAGATCTACG
TATTAAAGATCACACGGTAGCTCTCTATGAACAGCTGCAAACACAACGAT
TTTGGTTAGCCCCAGAAACTCTGAGGTTTCCAGATTTTATATCCGGAGTT
CTCTATCATCAAGGATATCCCTTGTATCCTCATGCATATGATACGTTGCT
TGAAGGAGATGTTTTTAATCTGTGGTTAGGTTACAGTCCTATAAGTAATG
CAACTATAGCTTTGTCTGTTGTAAAAAGTTTAGTCTGCCAACAAGATCTA
CAGCGACCTCTTTTAGATAGAGTATGCGAAATCAATGAGTGCTTGATTCG
CATGAAAATACCCATAGATGAAATGGGTATCTCTATACTCTGCCTCGAAA
TTTCGAAAGAAAATAAGGAACTCTCTTGGATAGCTTGTGGGAAAACCGTT
TTCTGGATAAAAAGACAGGGAAGGGTTGTCCAAGACTTTGAGAGCTTTTC
CCCAGGATTAGGGAAAATTACTTCTTTACAAATTCGAGAAACCAAGGTTG
CATGGGAAATAGGTGATGAAGCTGTAGTGTGTACGCTGGAATTAGAAGAA
TCTGTTGCATCCTTAAAAACCCTATCACTCGCAGAGTTGCAAGATAGAAG
GCAAAAAGCTATATTCTGTCCCATAGAGAGCATACATGGTGGAATACAAA
GTCGTCAGCACGGAAGTAACTCTCCCTCAACGCTCATTAGCTTAAAAAGA
ATCCGGTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy