Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Thr_3 tRNA_Lys_1 tRNA_Glu_1 IGR560 IGR555 IGR559 IGR558 IGR557 IGR556 CPn0706 CPn0705 CPn0704 yscC,sctC, - CPn0702 pyrH, - CPn0698 tsf, - CPn0697 karG, - CPn0701 CPn0706 CPn0705 CPn0704 yscC,sctC, - CPn0702 pyrH, - CPn0698 tsf, - CPn0697 karG, - CPn0701 CPn0705 CPn0704 yscC,sctC, - CPn0702 pkn5, - CPn0703 pkn5, - CPn0703 CPn0706 pyrH, - CPn0698 tsf, - CPn0697 karG, - CPn0701 CPn0700 rrf, - CPn0699 CPn0700 rrf, - CPn0699
* Calculated from Protein Sequence

Gene ID: CPn0702

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yscC  sctC  

Definition:
General secretion pathway precursor D protein (YopC translocation protein)

Gene Start:
789685

Gene Stop:
786926

Gene Length:
2760

Molecular Weight*:
100356

pI*:
6.40

Net Charge*:
-5.12

EC:
 

Functional Class:
cellular processes; secretion  

Pathway: pathway table
Membrane transport; Type II secretion system
Membrane transport; Type III secretion system

Comment:
Probably involved in a general secretion pathway for protein export (GSP).

YopC belongs to the ExeD/OutD/PulD/XpsD family.
See RUSSEL M. "ENVELOPE: TYPE-II PROTEIN SECRETION SYSTEMS." 1998. JOURNAL OF MOLECULAR BIOLOGY 279(3): 485-499.

Blast Summary:  PSI-Blast Search
CPn0702 is orthologously related to CT674: residues 4-919 of CPn0702 are 69% similar to residues 4-921 of CT674, a predicted general secretion pathway precursor D protein (YopC translocation protein) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1450
COG name: General secretion pathway protein D
Functional Class:  N
The phylogenetic pattern of COG1450 is -----QVcE--h------IN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 363 to 424 (E-value = 5e-12) place CPn0702 in the Secretin_N family which is described as Bacterial type II/III secretion system short domain (PF03958)
Residues 427 to 493 (E-value = 2.2e-10) place CPn0702 in the Secretin_N family which is described as Bacterial type II/III secretion system short domain (PF03958)
Residues 519 to 594 (E-value = 1.5e-10) place CPn0702 in the Secretin_N family which is described as Bacterial type II/III secretion system short domain (PF03958)
Residues 596 to 864 (E-value = 9.9e-77) place CPn0702 in the Secretin_C family which is described as Bacterial type II and III secretion system protein (PF00263)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
155
coil-coil  
156  
198
non-globular  
630  
806

PDB Hit:


Gene Protein Sequence:
VKTVILNIGRKILQGIKKKKKKIGILSGLFFLDLVLLGVSSQRPTETSAN
VKHNLRDEKLAACPKNSAASLSAKKSHTKKTTPGSIPSKVFSKFDATQDK
TFQKTSGSAFPAKPTTLKELEERKKPRPERRTTADVKRSPRFLPTQEVEE
PVPAASKEQLDSIQVWEEKQNYARRAVNAINLSIKKQLEEQTSTVTEKDV
QPKTQATPHASKKNVASPSTSMPGIEKAATTVAVPQDKSEEEKVKERLTK
RELTCEDLKDNGYTVNFEDISILELLQFVSKISGTNFVFDSNDLQFNVTI
VSHDPTSVDDLSTILLQVLKMHDLKVVEQGNNVLIYRNPHLSKLSTVVTD
SSLKETCEAVVVTRVFRLYSVSPSAAVNIIQPLLSHDAIVSASEATRHVI
ISDIAGNVDKVSDLLAALDCPGTSVDMTEYEVKYANPAALVSYCQDVLGT
LAEDDAFQMFIQPGTNKIFVVSSPRLANKAEQLLKSLDVPEMAHTLDDPA
STALALGGTGTTSPKSLRFFMYKLKYQNGEVIANALQDIGYNLYVTTAMD
EDFINTLNSIQWLEVNNSIVIIGNQGNVDRVIGLLNGLDLPPKQVYIEVL
ILDTSLEKSWDFGVQWVALGDEQSKVAYASGLLNNTGIATPTKATVPPGT
PNPGSIPLPTPGQLTGFSDMLNSSSAFGLGIIGNVLSHKGKSFLTLGGLL
SALDQDGDTVIVLNPRIMAQDTQQASFFVGQTVPYQTTNTIIQETGTVTQ
NIDYEDIGVNLVVTSTVAPNNVVTLQIEQTISELHSASGSLTPVTDKTYA
ATRLQIPDGCFLVMSGHIRDKTTKVVSGVPLLNSIPLIRGLFSRTIDQRQ
KRNIMMFIKPKVISSFEEGTRVTNKEGYRYNWEADEGSMQVAPRHAPECQ
GPPSLQAESDFKIIEIEAQ$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAAAACTGTGATATTGAACATTGGAAGAAAAATCTTGCAAGGCATCAA
AAAAAAGAAAAAAAAGATCGGGATTTTAAGTGGTCTCTTTTTTTTAGATT
TAGTTTTACTTGGTGTAAGTTCCCAGAGGCCTACAGAGACCTCGGCAAAT
GTAAAACACAATCTTAGAGATGAAAAGTTAGCTGCTTGTCCTAAAAATTC
AGCAGCCTCACTTTCAGCAAAGAAAAGTCATACCAAGAAAACCACTCCAG
GTTCTATCCCCAGTAAAGTCTTCTCTAAATTCGACGCAACCCAAGATAAA
ACTTTCCAAAAGACTTCAGGATCCGCATTCCCAGCAAAACCTACCACCCT
GAAAGAACTGGAAGAGAGAAAAAAACCTCGACCAGAGCGTAGAACTACTG
CCGATGTAAAAAGATCCCCACGCTTCTTACCAACACAAGAAGTCGAAGAG
CCTGTACCTGCCGCCTCTAAAGAACAATTAGATAGTATACAGGTTTGGGA
AGAAAAACAAAATTATGCTCGCAGAGCCGTAAATGCTATCAATCTGAGTA
TAAAAAAACAACTCGAAGAGCAAACCTCCACAGTTACAGAGAAAGACGTC
CAACCTAAAACACAAGCAACACCACACGCTTCGAAGAAAAACGTTGCAAG
TCCTTCGACCTCTATGCCAGGAATCGAGAAAGCAGCAACAACAGTGGCTG
TACCTCAAGACAAATCTGAAGAAGAAAAAGTTAAAGAGCGATTGACAAAG
CGGGAACTTACCTGTGAAGACCTTAAAGATAACGGCTATACTGTCAATTT
TGAAGACATTTCTATTTTAGAGTTGTTGCAGTTCGTAAGTAAAATTTCTG
GAACGAACTTTGTCTTTGATAGCAACGATTTGCAATTCAATGTCACGATC
GTTTCCCACGATCCTACTTCTGTAGATGATTTATCTACAATCTTACTACA
AGTCTTAAAAATGCATGACTTGAAGGTTGTTGAACAAGGCAATAACGTCC
TTATCTATCGTAATCCTCATCTTTCTAAGCTATCCACAGTAGTCACAGAC
AGCTCCTTAAAAGAAACGTGTGAAGCTGTTGTGGTTACCCGAGTGTTCCG
TCTTTACAGCGTCAGCCCCTCTGCAGCAGTAAATATTATTCAACCTTTAC
TTTCCCATGATGCTATCGTTAGTGCTTCAGAAGCTACTCGTCATGTTATC
ATCTCGGATATTGCTGGTAATGTCGATAAAGTCAGTGATTTGCTAGCAGC
TCTAGATTGCCCAGGCACATCTGTGGACATGACTGAATACGAAGTTAAAT
ATGCCAATCCCGCAGCTCTTGTTAGCTACTGCCAAGATGTTCTTGGTACT
CTGGCCGAAGATGATGCTTTCCAAATGTTCATCCAACCTGGAACGAACAA
AATTTTCGTCGTCTCTTCACCACGTCTTGCAAATAAGGCAGAGCAGCTCC
TGAAGTCCTTAGATGTCCCAGAAATGGCACATACCCTAGATGATCCTGCA
AGTACTGCCTTGGCTTTGGGAGGAACAGGAACCACGAGCCCTAAGAGTTT
GCGGTTCTTTATGTACAAGCTGAAGTATCAAAATGGAGAAGTGATTGCTA
ATGCCCTCCAAGATATCGGTTACAATCTATATGTAACCACAGCTATGGAC
GAAGATTTCATTAACACTCTCAATAGTATCCAGTGGTTAGAGGTCAATAA
CTCCATAGTTATTATCGGAAACCAAGGGAATGTCGACAGAGTTATTGGCC
TCTTAAACGGTTTAGATTTACCTCCTAAACAGGTTTACATCGAAGTTTTA
ATTCTAGATACCAGCTTAGAGAAATCCTGGGACTTTGGAGTGCAATGGGT
AGCCCTAGGTGATGAACAAAGTAAAGTAGCTTATGCTTCTGGACTATTGA
ATAATACTGGCATAGCCACACCTACAAAAGCAACTGTCCCTCCCGGCACG
CCAAATCCTGGTTCGATCCCTCTTCCTACGCCAGGACAATTGACAGGGTT
CTCAGATATGCTGAACTCTTCGTCAGCATTCGGTCTAGGAATCATCGGAA
ATGTCCTAAGTCATAAAGGGAAGTCTTTCCTTACTTTGGGAGGCTTATTA
AGTGCCTTAGATCAAGATGGAGATACTGTCATTGTCTTGAATCCTAGAAT
CATGGCTCAGGATACGCAACAAGCTTCGTTTTTTGTAGGGCAAACGGTCC
CTTACCAAACTACAAATACTATTATCCAAGAAACAGGAACTGTAACGCAA
AATATCGATTATGAAGATATTGGAGTGAACCTTGTCGTTACCTCTACAGT
TGCTCCCAACAATGTAGTTACACTACAAATCGAACAGACGATCTCAGAAT
TACATTCCGCGTCTGGATCACTAACACCTGTCACAGATAAAACTTATGCA
GCCACACGCTTACAAATTCCCGACGGTTGTTTCTTAGTTATGAGTGGGCA
TATCAGAGATAAAACTACAAAAGTGGTTTCAGGAGTGCCTTTGCTAAACT
CCATACCATTAATTCGTGGTTTATTTAGCCGTACCATCGACCAAAGGCAA
AAACGCAATATCATGATGTTTATTAAGCCTAAGGTGATTAGTAGCTTTGA
AGAAGGCACTCGTGTTACCAATAAGGAAGGATACAGATACAATTGGGAAG
CTGATGAAGGATCCATGCAAGTGGCCCCTCGCCATGCTCCTGAATGCCAA
GGACCTCCTTCTTTACAGGCTGAAAGTGACTTTAAAATAATAGAAATAGA
AGCTCAGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy