Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Gly_1 tRNA_Thr_3 tRNA_Lys_1 tRNA_Glu_1 IGR555 IGR557 IGR556 IGR554 yscC,sctC, - CPn0702 pyrH, - CPn0698 rs2, - CPn0696 tsf, - CPn0697 karG, - CPn0701 ompB,omp1, - CPn0695 yscC,sctC, - CPn0702 pyrH, - CPn0698 rs2, - CPn0696 tsf, - CPn0697 karG, - CPn0701 ompB,omp1, - CPn0695 yscC,sctC, - CPn0702 pkn5, - CPn0703 pkn5, - CPn0703 pyrH, - CPn0698 rs2, - CPn0696 tsf, - CPn0697 karG, - CPn0701 ompB,omp1, - CPn0695 CPn0700 rrf, - CPn0699 CPn0700 rrf, - CPn0699
* Calculated from Protein Sequence

Gene ID: CPn0701

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
karG  

Definition:
arginine kinase

Gene Start:
785599

Gene Stop:
786675

Gene Length:
1077

Molecular Weight*:
40129

pI*:
6.10

Net Charge*:
-5.57

EC:
2.7.3.3  

Functional Class:
uncategorized  

Pathway: pathway table
Amino Acid Metabolism; Arginine and proline metabolism

Comment:
In eukaryotes, arginine kinase is a cardiac and skeletal muscle
enzyme. Rarely encountered in bacteria.


Blast Summary:  PSI-Blast Search
CPn0701 is orthologously related to CT675: residues 3-347 of CPn0701 are 51% similar to residues 2-346 of CT675, a predicted arginine kinase from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 25 to 270 (E-value = 1.5e-05) place CPn0701 in the ATP-gua_Ptrans family which is described as ATP:guanido phosphotransferase, C-terminal catalytic domain (PF00217)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
184  
310

PDB Hit:


Gene Protein Sequence:
MTLPNDLLETLVKRKESPQANKVWPVTTFSLARNLSVSKFLPCLSKEQKL
EILQFITSHFNHIEGFGEFIVLPLKDTPLWQKEFLLEHFLLPYDLVGNPE
GEALVVSRSGDFLAAINFQDHLVLHGIDFQGNVEKTLDQLVQLDSYLHSK
LSFAFSSEFGFLTTNPKNCGTGLKSQCFLHIPALLYSKEFTNLIDEEVEI
ITSSLLLGVTGFPGNIVVLSNRCSLGLTEELLLSSLRITASKLSVAEVAA
KKRLSEENSGDLKNLILRSLGLLTHSCQLELKETLDALSWIQLGIDLGLI
KVTENHPLWNPLFWQIRRAHLALQKQAEDSRDLQKDTISHLRASVLKELT
KGLSPESF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCCTTCCTAATGATTTACTAGAGACCTTAGTAAAGAGAAAAGAAAG
TCCACAGGCAAACAAAGTGTGGCCTGTAACTACATTTTCTTTAGCTAGAA
ATCTCTCTGTATCTAAGTTCCTTCCCTGTTTATCTAAAGAACAGAAATTA
GAGATTCTCCAATTTATCACCTCTCATTTTAATCATATTGAAGGCTTTGG
GGAATTTATAGTGCTTCCTCTAAAAGACACTCCCCTATGGCAGAAAGAGT
TTCTACTTGAGCATTTTTTACTCCCTTATGATTTGGTGGGGAACCCAGAA
GGTGAGGCATTAGTAGTTAGCAGATCTGGAGACTTCTTAGCAGCTATAAA
TTTTCAAGATCATCTTGTTTTACATGGAATTGATTTCCAAGGAAATGTTG
AGAAAACTCTTGATCAACTTGTACAATTGGATAGTTATCTCCATAGCAAG
TTATCTTTTGCTTTTTCTTCAGAATTTGGATTTTTAACAACCAATCCTAA
GAACTGTGGGACGGGGTTAAAAAGCCAATGTTTTCTGCATATTCCTGCGC
TTCTATATTCTAAAGAATTTACCAATCTTATTGATGAAGAGGTGGAGATA
ATTACTTCTAGTTTATTACTAGGGGTTACAGGATTTCCTGGCAATATTGT
GGTATTATCGAATCGTTGTTCTTTAGGGCTCACTGAAGAACTGCTTCTTT
CTTCTTTAAGGATTACTGCTTCCAAGCTCAGTGTTGCTGAGGTTGCAGCA
AAAAAACGGCTTTCTGAGGAGAATTCTGGCGATTTAAAGAATCTTATCCT
TCGTTCCTTAGGTCTACTTACCCATTCCTGCCAACTTGAGCTGAAAGAGA
CTCTAGATGCCTTGAGCTGGATACAACTGGGTATAGATTTAGGCTTGATT
AAAGTAACCGAAAATCATCCCCTATGGAATCCATTATTTTGGCAAATACG
TCGAGCACATCTTGCCTTGCAAAAACAAGCTGAAGACTCCCGGGATCTGC
AAAAAGATACGATTTCACATTTAAGAGCTAGCGTATTGAAGGAGTTAACT
AAAGGATTATCTCCTGAGAGTTTCTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy