Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Gly_1 tRNA_Thr_3 tRNA_Lys_1 tRNA_Glu_1 IGR555 IGR557 IGR556 IGR554 yscC,sctC, - CPn0702 pyrH, - CPn0698 rs2, - CPn0696 tsf, - CPn0697 karG, - CPn0701 ompB,omp1, - CPn0695 yscC,sctC, - CPn0702 pyrH, - CPn0698 rs2, - CPn0696 tsf, - CPn0697 karG, - CPn0701 ompB,omp1, - CPn0695 yscC,sctC, - CPn0702 pkn5, - CPn0703 pkn5, - CPn0703 pyrH, - CPn0698 rs2, - CPn0696 tsf, - CPn0697 karG, - CPn0701 ompB,omp1, - CPn0695 CPn0700 rrf, - CPn0699 CPn0700 rrf, - CPn0699
* Calculated from Protein Sequence

Gene ID: CPn0700

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
785097

Gene Stop:
785612

Gene Length:
516

Molecular Weight*:
19208

pI*:
6.70

Net Charge*:
-1.32

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0700 is orthologously related to CT676: residues 9-169 of CPn0700 are 54% similar to residues 11-171 of CT676, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 130 to 165 (E-value = 8.1e-07) place CPn0700 in the UVR family which is described as UvrB/uvrC motif (PF02151)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
130  
171

PDB Hit:


Gene Protein Sequence:
MVHSPTHQCYHCQQPATICYTEIDKDKVIRSYVCATCPCPSHYYNNEHLS
LSKGVGVLTLECGNCKTVWHSKQDDEQLLGCHQCYTNFKNQITSKLKSER
VVSSSFTMEKGQGSLHIGRAPGEASNTNPLLKLIALNEALQDTLEREDYE
QAAVIRDQINHLKTKNPDDPS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTCACTCACCTACCCACCAATGTTATCATTGTCAACAGCCTGCCAC
CATATGCTATACAGAAATAGATAAGGATAAGGTTATACGCTCTTATGTAT
GCGCAACATGTCCTTGTCCTAGCCATTACTATAATAATGAGCACCTGAGT
CTATCTAAAGGGGTTGGGGTTCTCACTTTAGAGTGCGGCAACTGTAAAAC
CGTATGGCATTCAAAGCAAGACGACGAACAACTGTTAGGCTGCCACCAAT
GTTATACAAATTTCAAAAATCAGATTACCAGCAAACTCAAAAGTGAGAGA
GTGGTATCTTCATCCTTTACTATGGAGAAAGGCCAAGGCTCTCTTCATAT
AGGTCGAGCCCCTGGGGAAGCTTCCAATACAAATCCTCTTTTAAAACTTA
TAGCATTAAATGAAGCTTTACAAGATACCTTAGAACGAGAGGACTACGAG
CAAGCAGCAGTAATCCGAGATCAGATTAATCATTTAAAAACCAAAAATCC
AGATGACCCTTCCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy