Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Gly_1 tRNA_Thr_3 tRNA_Lys_1 tRNA_Glu_1 IGR555 IGR557 IGR556 IGR554 IGR553 yscC,sctC, - CPn0702 pbpB, - CPn0694 pyrH, - CPn0698 rs2, - CPn0696 tsf, - CPn0697 karG, - CPn0701 ompB,omp1, - CPn0695 yscC,sctC, - CPn0702 pbpB, - CPn0694 pyrH, - CPn0698 rs2, - CPn0696 tsf, - CPn0697 karG, - CPn0701 ompB,omp1, - CPn0695 yscC,sctC, - CPn0702 pbpB, - CPn0694 pyrH, - CPn0698 rs2, - CPn0696 tsf, - CPn0697 karG, - CPn0701 ompB,omp1, - CPn0695 CPn0700 rrf, - CPn0699 CPn0700 rrf, - CPn0699
* Calculated from Protein Sequence

Gene ID: CPn0699

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rrf  

Definition:
ribosome recycling factor

Gene Start:
784182

Gene Stop:
784724

Gene Length:
543

Molecular Weight*:
20154

pI*:
8.60

Net Charge*:
2.39

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table

Comment:
This protein regarded to be essential for
release of ribosomes from mRNA upon
termination.

The intergenic spacing between CT677 and CT676
is 373 bp.
The intergenic spacing between CT678 and CT679
is 15 bp.
The intergenic spacing between CT680 and CT681
is 372 bp.
CT678 overlaps with CT677. (The stop codon of
CT678 overlaps with the start codon of CT677,
ATGA)
CT680 overlaps with CT679. (The stop codon of
CT680 overlaps with the start codon of CT679,
ATGA)
The potential translational coupling and the
compact intergenic spacing from CT680 to CT677
suggest the possibility of a single
transcriptional unit.

Blast Summary:  PSI-Blast Search
CPn0699 is similar to UU512 in U. urealyticum,
TP0604 in T. pallidum and MG435 in M. genitalium.

CPn0699 is orthologously related to CT677:
residues 4-180 are 70% similar to residues 3-179 of CT677.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0233
COG name: Ribosome recycling factor
Functional Class:  J
The phylogenetic pattern of COG0233 is ----yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 17 to 178 (E-value = 5.2e-72) place CPn0699 in the RRF family which is described as Ribosome recycling factor (PF01765)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
105  
180

PDB Hit:


Gene Protein Sequence:
MSVLQDTEKKMAAALDFFHKEVKSFRTGKAHPALVETVVVDVYGTTMRLS
DIASISVADLRQLVISPYDGNNASAIAKGIIAANLNLQPEVEGSIIRIKV
PEPTADYRQEMIKQLRRKCEEAKINVRNIRREANDKLKKDSALTEDVVKG
NEKKIQELTDKFCKQLDELTKQKEAEIASI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTGTTCTCCAAGACACTGAGAAAAAAATGGCTGCGGCTTTAGATTT
TTTTCATAAAGAAGTAAAGTCCTTTAGAACAGGAAAAGCTCATCCAGCAT
TAGTAGAAACTGTTGTAGTCGATGTTTATGGCACTACAATGCGTTTGTCT
GATATCGCTTCGATTTCTGTTGCAGATCTTCGGCAATTGGTTATTTCTCC
CTATGACGGGAACAATGCTTCTGCCATTGCAAAAGGAATTATTGCAGCGA
ATTTAAACTTACAGCCTGAAGTCGAAGGGTCTATTATTCGTATTAAGGTC
CCTGAGCCTACTGCTGATTACCGACAAGAGATGATTAAGCAACTTCGCCG
CAAGTGTGAAGAAGCTAAGATCAACGTTAGAAATATCCGCAGAGAAGCTA
ATGACAAGTTGAAAAAAGACTCGGCTCTTACAGAAGATGTTGTCAAAGGT
AACGAGAAAAAAATTCAGGAGTTAACTGACAAGTTTTGCAAGCAGCTTGA
TGAGTTAACAAAGCAAAAAGAAGCTGAAATAGCTTCAATATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy