Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Gly_1 tRNA_Thr_3 tRNA_Lys_1 tRNA_Glu_1 IGR555 IGR557 IGR556 IGR554 IGR553 yscC,sctC, - CPn0702 pbpB, - CPn0694 pyrH, - CPn0698 rs2, - CPn0696 tsf, - CPn0697 karG, - CPn0701 ompB,omp1, - CPn0695 yscC,sctC, - CPn0702 pbpB, - CPn0694 pyrH, - CPn0698 rs2, - CPn0696 tsf, - CPn0697 karG, - CPn0701 ompB,omp1, - CPn0695 yscC,sctC, - CPn0702 pbpB, - CPn0694 pyrH, - CPn0698 rs2, - CPn0696 tsf, - CPn0697 karG, - CPn0701 ompB,omp1, - CPn0695 CPn0700 rrf, - CPn0699 CPn0700 rrf, - CPn0699
* Calculated from Protein Sequence

Gene ID: CPn0698

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pyrH  

Definition:
uridylate kinase

Gene Start:
783458

Gene Stop:
784204

Gene Length:
747

Molecular Weight*:
27084

pI*:
5.40

Net Charge*:
-5.08

EC:
2.7.4.-  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides; pyrimidine ribonucleotide biosynthesis  

Pathway: pathway table

Comment:
This protein, like CT678, may have both UMP kinase and aspartokinase potential.

Blast Summary:  PSI-Blast Search
CPn0698 is orthologously related to CT678, a predicted uridylate kinase:
residues 1-237 are 73% similar to CT678. CPn0698 is also similar to UU513
and MG434. It is very weakly similar to TP0099, a predicted uridylate kinase.

COGS Summary:  COGS Search
BeTs to 16 clades of COG0528
COG name: Uridylate kinase
Functional Class:  F
The phylogenetic pattern of COG0528 is amtk-qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 6 to 217 (E-value = 6.8e-56) place CPn0698 in the AA_kinase family which is described as Amino acid kinase family (PF00696)

PDB Hit:


Gene Protein Sequence:
MAKQTRRVLFKISGEALSKDSSNRIDEMRLSRLVSELRAVRNNDIEIALV
IGGGNILRGLAEQKELQINRVSADQMGMLATLINGMAVADALKAEDIPCL
LTSTLSCPQLADLYTPQKSIEALDQGKILICTTGAGSPYLTTDTGAALRA
CELNVDVLIKATMHVDGVYDKDPRLFPDAVKYDFVSYKDFLSNQLGVMDA
SAISLCMDSHIPIRVFSFLQHSLEKALFDPTIGTLVSEDVNHVCSPRH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTAAGCAAACTAGACGAGTCTTGTTTAAAATTTCTGGGGAAGCATT
ATCTAAAGATTCTAGCAATAGAATTGATGAAATGCGTTTATCCCGACTGG
TATCAGAGCTAAGAGCAGTTCGTAATAATGATATAGAAATCGCCCTTGTA
ATCGGCGGTGGCAATATTTTAAGAGGACTCGCTGAGCAAAAGGAACTTCA
AATTAATCGTGTATCGGCAGATCAAATGGGAATGCTGGCTACCTTGATCA
ATGGTATGGCAGTAGCAGATGCTTTAAAAGCTGAGGATATCCCTTGTCTT
TTGACATCTACCCTATCGTGCCCACAGTTAGCTGATCTTTATACTCCACA
AAAATCAATAGAAGCTTTAGACCAGGGAAAGATTCTTATCTGCACCACTG
GAGCTGGTTCTCCTTATCTGACTACAGATACTGGAGCTGCTTTACGAGCT
TGTGAGCTTAATGTTGACGTTTTAATCAAAGCGACTATGCATGTAGACGG
TGTCTATGATAAAGATCCTAGGCTCTTTCCAGATGCTGTAAAATATGATT
TTGTTTCCTATAAGGATTTTTTGAGCAATCAACTAGGGGTAATGGATGCA
TCAGCAATTTCCCTATGTATGGATTCTCATATTCCAATTCGTGTCTTTAG
CTTTTTACAGCACTCTCTAGAAAAGGCTCTATTTGACCCTACGATTGGAA
CATTAGTTAGCGAGGATGTAAACCATGTCTGTTCTCCAAGACACTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy