Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Gly_1 tRNA_Thr_3 tRNA_Lys_1 tRNA_Glu_1 IGR555 IGR557 IGR556 IGR554 IGR553 yscC,sctC, - CPn0702 pbpB, - CPn0694 pyrH, - CPn0698 rs2, - CPn0696 tsf, - CPn0697 karG, - CPn0701 ompB,omp1, - CPn0695 yscC,sctC, - CPn0702 pbpB, - CPn0694 pyrH, - CPn0698 rs2, - CPn0696 tsf, - CPn0697 karG, - CPn0701 ompB,omp1, - CPn0695 yscC,sctC, - CPn0702 pbpB, - CPn0694 pyrH, - CPn0698 rs2, - CPn0696 tsf, - CPn0697 karG, - CPn0701 ompB,omp1, - CPn0695 CPn0700 rrf, - CPn0699 CPn0700 rrf, - CPn0699
* Calculated from Protein Sequence

Gene ID: CPn0696

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rs2  

Definition:
30S ribosomal protein S2

Gene Start:
781769

Gene Stop:
782602

Gene Length:
834

Molecular Weight*:
31254

pI*:
8.80

Net Charge*:
5.27

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:


Blast Summary:  PSI-Blast Search
CPn0696 is similar to TP0606 in T. pallidum,
UU026 in U. urealyticum and MG070 in M. genitalium.

CPn0696 is orthologously related to CT680:
residues 5-261 are 66% similar to residues 4-267 of CT680.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0052
COG name: Ribosomal protein S2
Functional Class: J
The phylogenetic pattern of COG0052 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 13 to 228 (E-value = 4e-90) place CPn0696 in the Ribosomal_S2 family which is described as Ribosomal protein S2 (PF00318)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
108  
154
coil-coil  
250  
277

PDB Hit:


Gene Protein Sequence:
LESQSCKLTIKDLMSAGAHFGHQTRRWNPKMKLYIFEEKNGLYIINLAKT
LQQLRNALPHIRKVIQDNKTVLFVGTKKQAKCVIREAAIEAGEFFIAERW
LGGMLTNMTTIRNSIKTLDKIEKDLSRNQAYLTKKEAALLAKRHQKLLRN
LEGIRYMKKAPGLLVVVDPSYEKIAVAEAKKLGIPVLALVDTNCDPTPID
HVIPCNDDSLKSIRLIINVIKENIIEAKHKLGIEIVSPVKSLEVPDLSAF
ESSQDDESDEENREEDLLAKKFDGEAN$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGAATCCCAATCCTGCAAACTTACAATTAAAGACCTTATGAGTGCCGG
TGCTCATTTTGGACACCAAACTCGAAGATGGAACCCAAAGATGAAACTTT
ACATCTTTGAGGAGAAAAACGGTCTTTACATCATCAATCTAGCAAAAACT
TTACAGCAATTACGCAATGCTCTTCCCCACATTCGCAAAGTAATTCAAGA
CAATAAAACTGTCCTATTCGTAGGAACAAAAAAACAAGCAAAGTGTGTCA
TTCGAGAAGCTGCAATAGAAGCTGGCGAATTTTTTATTGCTGAACGTTGG
CTAGGCGGAATGTTAACCAACATGACGACTATCCGAAATTCCATTAAAAC
GTTAGACAAAATTGAAAAAGATTTATCTAGAAATCAGGCCTATCTTACTA
AGAAAGAAGCAGCTCTTTTAGCTAAACGTCATCAAAAATTATTGCGAAAC
CTTGAAGGGATTCGTTACATGAAGAAGGCTCCTGGTCTTCTAGTTGTTGT
TGACCCTAGCTATGAAAAAATTGCTGTTGCAGAAGCAAAAAAACTCGGAA
TTCCTGTTCTTGCTCTCGTCGATACTAACTGCGATCCTACTCCTATCGAC
CATGTGATCCCCTGTAATGATGACTCTCTTAAAAGCATTCGATTAATCAT
CAATGTGATTAAAGAAAATATTATCGAGGCCAAACATAAGCTTGGTATAG
AAATTGTTTCTCCAGTGAAATCTTTAGAAGTGCCCGATCTCTCAGCTTTC
GAATCTAGCCAAGATGACGAATCTGACGAAGAGAATCGAGAAGAAGATCT
ATTAGCAAAAAAATTTGATGGCGAGGCAAACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy