Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Gly_1 tRNA_Lys_1 tRNA_Glu_1 IGR555 IGR552 IGR556 IGR554 IGR553 CPn0693 pbpB, - CPn0694 pyrH, - CPn0698 rs2, - CPn0696 tsf, - CPn0697 karG, - CPn0701 ompB,omp1, - CPn0695 CPn0693 pbpB, - CPn0694 pyrH, - CPn0698 rs2, - CPn0696 tsf, - CPn0697 karG, - CPn0701 ompB,omp1, - CPn0695 CPn0693 pbpB, - CPn0694 pyrH, - CPn0698 rs2, - CPn0696 tsf, - CPn0697 ompB,omp1, - CPn0695 CPn0700 rrf, - CPn0699 rrf, - CPn0699 karG, - CPn0701 CPn0700
* Calculated from Protein Sequence

Gene ID: CPn0695

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ompB  omp1  

Definition:
major outer membrane protein (MOMP)

Gene Start:
780216

Gene Stop:
781385

Gene Length:
1170

Molecular Weight*:
41607

pI*:
7.50

Net Charge*:
1.54

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0695 is orthologously related to CT681: residues 1-389 of CPn0695 are 64% similar to residues 1-393 of CT681, a predicted major outer membrane protein (MOMP) (ompB) from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 389 (E-value = 2.2e-302) place CPn0695 in the Chlam_OMP family which is described as Chlamydia major outer membrane protein (PF01308)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
23

PDB Hit:


Gene Protein Sequence:
MKKLLKSALLSAAFAGSVGSLQALPVGNPSDPSLLIDGTIWEGAAGDPCD
PCATWCDAISLRAGFYGDYVFDRILKVDAPKTFSMGAKPTGSAAANYTTA
VDRPNPAYNKHLHDAEWFTNAGFIALNIWDRFDVFCTLGASNGYIRGNST
AFNLVGLFGVKGTTVNANELPNVSLSNGVVELYTDTSFSWSVGARGALWE
CGCATLGAEFQYAQSKPKVEELNVICNVSQFSVNKPKGYKGVAFPLPTDA
GVATATGTKSATINYHEWQVGASLSYRLNSLVPYIGVQWSRATFDADNIR
IAQPKLPTAVLNLTAWNPSLLGNATALSTTDSFSDFMQIVSCQINKFKSR
KACGVTVGATLVDADKWSLTAEARLINERAAHVSGQFRF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAACTCTTAAAGTCGGCGTTATTATCCGCCGCATTTGCTGGTTC
TGTTGGCTCCTTACAAGCCTTGCCTGTAGGGAACCCTTCTGATCCAAGCT
TATTAATTGATGGTACAATATGGGAAGGTGCTGCAGGAGATCCTTGCGAT
CCTTGCGCTACTTGGTGCGACGCTATTAGCTTACGTGCTGGATTTTACGG
AGACTATGTTTTCGACCGTATCTTAAAAGTAGATGCACCTAAAACATTTT
CTATGGGAGCCAAGCCTACTGGATCCGCTGCTGCAAACTATACTACTGCC
GTAGATAGACCTAACCCGGCCTACAATAAGCATTTACACGATGCAGAGTG
GTTCACTAATGCAGGCTTCATTGCCTTAAACATTTGGGATCGCTTTGATG
TTTTCTGTACTTTAGGAGCTTCTAATGGTTACATTAGAGGAAACTCTACA
GCGTTCAATCTCGTTGGTTTATTCGGAGTTAAAGGTACTACTGTAAATGC
AAATGAACTACCAAACGTTTCTTTAAGTAACGGAGTTGTTGAACTTTACA
CAGACACCTCTTTCTCTTGGAGCGTAGGCGCTCGTGGAGCCTTATGGGAA
TGCGGTTGTGCAACTTTGGGAGCTGAATTCCAATATGCACAGTCCAAACC
TAAAGTTGAAGAACTTAATGTGATCTGTAACGTATCGCAATTCTCTGTAA
ACAAACCCAAGGGCTATAAAGGCGTTGCTTTCCCCTTGCCAACAGACGCT
GGCGTAGCAACAGCTACTGGAACAAAGTCTGCGACCATCAATTATCATGA
ATGGCAAGTAGGAGCCTCTCTATCTTACAGACTAAACTCTTTAGTGCCAT
ACATTGGAGTACAATGGTCTCGAGCAACTTTTGATGCTGATAACATCCGC
ATTGCTCAGCCAAAACTACCTACAGCTGTTTTAAACTTAACTGCATGGAA
CCCTTCTTTACTAGGAAATGCCACAGCATTGTCTACTACTGATTCGTTCT
CAGACTTCATGCAAATTGTTTCCTGTCAGATCAACAAGTTTAAATCTAGA
AAAGCTTGTGGAGTTACTGTAGGAGCTACTTTAGTTGATGCTGATAAATG
GTCACTTACTGCAGAAGCTCGTTTAATTAACGAGAGAGCTGCTCACGTAT
CTGGTCAGTTCAGATTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy