Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Gly_1 IGR550 IGR552 IGR551 IGR554 IGR553 abcX, - CPn0691 CPn0693 CPn0692 pbpB, - CPn0694 rs2, - CPn0696 tsf, - CPn0697 ompB,omp1, - CPn0695 abcX, - CPn0691 CPn0693 CPn0692 pbpB, - CPn0694 rs2, - CPn0696 tsf, - CPn0697 ompB,omp1, - CPn0695 abcX, - CPn0691 CPn0693 CPn0692 pbpB, - CPn0694 rs2, - CPn0696 tsf, - CPn0697 ompB,omp1, - CPn0695
* Calculated from Protein Sequence

Gene ID: CPn0694

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pbpB  

Definition:
probable penicillin binding protein 2 (transglycosylase/transpeptidase)

Gene Start:
779599

Gene Stop:
776327

Gene Length:
3273

Molecular Weight*:
124075

pI*:
6.80

Net Charge*:
-2.32

EC:
 

Functional Class:
cell envelope; peptidoglycan  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0694 is orthologously related to CT682: residues 1-1084 of CPn0694 are 58% similar to residues 1-1077 of CT682, a predicted penicillin binding protein 2 (transglycosylase/transpeptidase) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0768
COG name: Cell division protein FtsI/penicillin-binding protein 2
Functional Class:  M
The phylogenetic pattern of COG0768 is -----QVcEBRHUJ--OLINX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 59 to 294 (E-value = 8.5e-58) place CPn0694 in the PBP_dimer family which is described as Penicillin-binding Protein dimerisation domain (PF03717)
Residues 736 to 1076 (E-value = 7.4e-06) place CPn0694 in the Transpeptidase family which is described as Penicillin binding protein transpeptidase domain (PF00905)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
21  
38
non-globular  
298  
366
transmembrane  
924  
941

PDB Hit:


Gene Protein Sequence:
MKRPKKFPIYLSIAQKTNRLLSGIVIAFAVIALRLWYLAVVEHEQKLEEA
YKPQIRVLPQYVERATICDRFGKTLAVNQLQYDVSVAYGAIRDLPTRAWR
VDEHGHKQLIPVRKHYIMCLSELLSQELHLDREAIEDAIHAKASVLGSVP
YLVAANVSERTYLKLKMLSKDWPGLHVEAVVRRHYPQESVASDILGYVGP
ISLQEYKRVTQELSQLRECVRAYEEGEDPKLPEGLASIDQVRALLESVES
NAYSLNALVGKMGVEACWDSKLRGKIGKKPILVDRRGNFIQEMEGAVPEA
PGTKLQLTLSAELQAYADALLLEYEKTETFRSAKSLKKREKLPPLFPWIK
GGAIIALDPNNGEILAMASSPRYRNNDFVNAKVAEDSKAVRSSIYRWLEN
KEHIAEIYDRKVPLIRERRNPLTGLCYEEILPLTFDCFLDFLFPENSVIK
LQLKRNSFVGQAIEVQNLVTRLLSLFPYEEGTCPCSAIFDAVFPNEEGHI
LIQEVISLQEQKWIMECLNQHKADIEELKEALDQVFNELPANYDKILYTD
ILRLIVDPERFSPVLPSEVHRLSLSEFTELQGRYVVLRSAFSTILEDAFI
EVHFKSWRKSEFLQYLAAKRQEEALRKQRYPTPYVDYLEEEKTRQYKMFC
QEHLDTFLAYLFSKTPYKEGLEPYYDILDLWINELDNGAHRALSWHEHYL
FLKERVSHLSEHLPALFSTFREFNELQRPLLGKYPISIVRNKRQTEQDLA
ASFYPVYGYGYLRPHAYGQAATLGSIFKLVSAYSVLSQRILWGHNEEPAN
PLVIIDKNSFGYRSSKPHVGFFKDGTPIPTFFRGGSLPGNDFMGRGFIDL
VSALEMSSNPYFSLLVGEGLGDPEDLADAASLFGFGEKTGLGLPGEYAGR
VPHDLAYNRSGLYATAIGQHTLVVTPLQTAVMLASLVNGGVVYVPKLLLG
EWEGEHVSYLSSKKKRTIFMPDAVVEVLKTGMRNVIWGQYGTARAIQSQF
PPQLLSRIIGKTSTAESIMRVGLDREYGTMKMKDIWFAAVGFSDQDLSLP
TIVVIVYLRLGEFGRDAAPMAVKMIDMWEKIQQRESFLRG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACGACCGAAAAAATTTCCTATTTATCTTTCCATTGCTCAAAAGAC
CAACAGACTGTTGTCTGGGATTGTTATTGCATTTGCTGTGATTGCATTGC
GTTTATGGTATCTTGCTGTTGTTGAACATGAACAAAAGTTAGAAGAGGCA
TACAAGCCACAGATTCGAGTGCTTCCTCAATATGTGGAAAGAGCAACGAT
TTGTGATCGTTTTGGAAAGACATTGGCTGTGAATCAGTTGCAATATGATG
TGAGCGTTGCTTATGGGGCCATTCGTGATTTGCCTACTCGGGCTTGGCGT
GTCGATGAGCATGGGCATAAACAGCTCATTCCTGTGCGTAAGCATTATAT
AATGTGTTTGTCTGAGCTTTTATCTCAGGAATTGCATTTAGATCGCGAGG
CGATCGAAGATGCAATTCATGCAAAAGCTTCTGTATTAGGTTCGGTCCCT
TATTTAGTGGCTGCTAATGTTTCTGAGCGCACCTATTTGAAACTCAAAAT
GTTATCTAAAGATTGGCCTGGATTGCATGTAGAGGCTGTAGTTCGTCGTC
ATTATCCTCAAGAAAGCGTGGCTTCAGATATTTTAGGTTATGTAGGACCT
ATCAGTCTTCAAGAGTATAAGAGAGTCACTCAGGAGCTGAGTCAATTGCG
TGAGTGTGTGCGTGCTTATGAAGAGGGTGAAGATCCTAAGTTGCCTGAAG
GATTAGCAAGTATAGATCAGGTGCGTGCTTTATTAGAGTCTGTGGAGAGC
AACGCTTATAGTTTAAATGCTTTAGTAGGAAAAATGGGTGTTGAGGCCTG
TTGGGACTCAAAATTACGAGGTAAGATCGGAAAAAAACCGATTTTAGTAG
ATCGTCGTGGGAACTTCATTCAAGAAATGGAGGGTGCTGTTCCTGAAGCT
CCTGGAACTAAATTGCAGTTGACTTTGTCTGCTGAGCTACAAGCGTATGC
GGATGCGTTACTTTTAGAATATGAAAAAACGGAGACGTTTCGTAGTGCTA
AGTCATTGAAGAAACGAGAGAAGCTTCCTCCTTTGTTCCCTTGGATTAAA
GGAGGAGCCATTATTGCGTTAGATCCTAATAACGGAGAGATTTTAGCCAT
GGCTTCTTCTCCCCGTTATCGTAACAATGATTTTGTGAATGCGAAGGTTG
CGGAAGATTCTAAAGCGGTAAGATCGTCTATTTATCGATGGTTAGAAAAT
AAAGAGCATATTGCAGAAATTTATGATAGGAAAGTCCCTCTAATTCGGGA
AAGAAGGAATCCTCTTACTGGATTATGTTATGAAGAGATTTTGCCATTAA
CCTTTGATTGCTTCCTTGATTTTCTTTTCCCTGAAAACTCTGTGATTAAA
TTGCAGTTAAAAAGAAACAGCTTTGTAGGACAGGCGATAGAGGTTCAAAA
CTTGGTGACTCGTTTGCTTTCTTTATTTCCTTATGAAGAGGGGACGTGTC
CTTGTTCCGCTATTTTTGATGCAGTTTTCCCTAATGAAGAGGGGCATATC
TTAATCCAAGAAGTCATTTCTCTTCAGGAACAAAAATGGATCATGGAATG
TCTGAATCAGCATAAAGCAGATATTGAAGAGCTTAAGGAAGCATTAGACC
AAGTTTTTAATGAGCTTCCTGCGAATTACGATAAAATCTTGTATACGGAT
ATCCTTAGGCTGATTGTAGATCCAGAGCGTTTTTCTCCTGTACTTCCTTC
AGAGGTTCATAGGCTCTCGTTATCTGAATTTACAGAGCTTCAAGGACGTT
ATGTGGTGCTTCGCTCTGCATTCTCTACTATTTTAGAAGATGCTTTTATT
GAGGTGCATTTTAAGTCGTGGCGTAAGAGTGAATTTCTTCAATATCTTGC
TGCGAAACGTCAAGAGGAAGCATTAAGGAAACAGAGGTATCCTACACCTT
ATGTAGATTACTTAGAGGAAGAAAAAACAAGGCAATATAAAATGTTCTGC
CAAGAACATTTGGATACATTTCTTGCGTATTTATTTTCTAAAACCCCTTA
TAAAGAAGGCTTAGAGCCTTACTATGATATTTTAGATTTATGGATAAATG
AATTAGATAATGGAGCGCATAGAGCGTTATCTTGGCACGAACATTATCTT
TTTCTAAAAGAACGTGTGTCGCATCTTTCAGAACATCTCCCTGCACTTTT
TTCTACATTTCGTGAATTCAATGAATTGCAACGTCCTCTATTAGGCAAAT
ATCCCATCTCGATTGTGAGAAATAAGAGGCAGACAGAACAAGATTTAGCT
GCTTCTTTTTATCCAGTATATGGATACGGATACCTACGTCCTCATGCCTA
CGGGCAAGCAGCTACCTTAGGTTCTATTTTTAAGTTAGTATCTGCATATT
CTGTGTTATCTCAGAGGATCTTATGGGGACATAATGAGGAGCCTGCGAAT
CCCTTGGTCATTATTGATAAAAATTCCTTTGGCTATAGGAGTTCTAAGCC
TCACGTGGGCTTTTTTAAAGATGGCACACCGATTCCCACGTTTTTCCGTG
GGGGGAGTTTGCCGGGAAATGATTTCATGGGAAGAGGCTTTATTGATTTA
GTCTCAGCATTAGAGATGTCTAGCAACCCGTACTTTTCATTATTGGTAGG
GGAAGGTCTTGGGGATCCTGAAGATTTAGCAGACGCGGCTTCTTTATTTG
GTTTTGGCGAGAAAACAGGTTTAGGATTGCCAGGAGAGTATGCGGGTAGG
GTGCCTCATGATTTGGCGTATAACCGTTCCGGTTTATACGCAACAGCGAT
TGGACAGCATACTCTTGTTGTAACTCCTTTGCAGACAGCAGTGATGTTAG
CTTCTTTAGTTAATGGCGGTGTGGTTTATGTCCCCAAGTTATTGCTTGGA
GAATGGGAGGGGGAGCATGTTTCTTATCTCTCTTCTAAAAAGAAGCGAAC
GATTTTCATGCCTGATGCTGTAGTAGAGGTGCTTAAGACTGGCATGCGCA
ATGTTATCTGGGGTCAATACGGAACAGCTCGAGCAATACAAAGTCAATTT
CCTCCACAACTTTTGTCTCGTATTATTGGAAAGACAAGTACAGCAGAGTC
CATTATGCGTGTGGGACTGGATCGGGAATATGGTACCATGAAAATGAAAG
ACATCTGGTTTGCTGCGGTGGGTTTTTCTGATCAAGATTTATCTCTTCCT
ACGATCGTAGTCATAGTCTATTTACGCTTAGGAGAATTTGGTCGAGATGC
GGCTCCTATGGCGGTAAAAATGATTGATATGTGGGAAAAAATTCAACAAA
GAGAATCTTTTTTAAGGGGATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy