Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR549 IGR550 IGR548 IGR552 IGR551 IGR553 abcX, - CPn0691 CPn0693 yfhO,nifS, - CPn0689 CPn0690 CPn0692 pbpB, - CPn0694 ompB,omp1, - CPn0695 abcX, - CPn0691 CPn0693 yfhO,nifS, - CPn0689 CPn0690 CPn0692 pbpB, - CPn0694 ompB,omp1, - CPn0695 abcX, - CPn0691 CPn0693 yfhO,nifS, - CPn0689 CPn0690 CPn0692 pbpB, - CPn0694 ompB,omp1, - CPn0695
* Calculated from Protein Sequence

Gene ID: CPn0693

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
O-linked GlcNAc transferase

Gene Start:
776256

Gene Stop:
775237

Gene Length:
1020

Molecular Weight*:
38679

pI*:
5.20

Net Charge*:
-11.89

EC:
 

Functional Class:
cellular processes; signal transduction  
uncategorized  

Pathway: pathway table

Comment:
This protein is thought to play a role in metabolism of macromolecules, transcription--mRNA synthesis --and modification through addition of O-linked GlcNAc to transcription factors and nuclear pore proteins.
Contains TPR-repeat.
See CT683.

Blast Summary:  PSI-Blast Search
Several significant hits in gapped BLAST to O-linked GlcNAc transferase sequences; residues 8-277 are 31% similar to (AE000799) O-linked GlcNAc transferase [Methanobacterium thermoautotrophicum]; residues 15-302 OGT1_RAT; residues 13-302 are 24% similar to (U77412) O-linked GlcNAc transferase [Caenorhabditis elegans]; residues 1-324 are 77% similar to CT683; and residues 21-275 are 27% similar to TP0954.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0457
COG name: TPR-repeat-containing proteins
Functional Class:  R
The phylogenetic pattern of COG0457 is AMTKYQVCEB-HUJ--OLINX
Number of proteins in this genome belonging to this COG is 10

Blocks Summary:  Blocks Search
Residues 16-278 span six regions of similarity to block PF00515 (TPR Domain) with a combined E-value of 9.4e-06.

ProDom Summary:  Protein Domain Search
Residues 92-171 are 31% similar to a defined domain of O26186_METTH, defined as: O-LINKED GLCNAC TRANSFERASE.
Residues 106-182 are 31% similar to a defined domain of O26186_METTH, defined as: PROTEIN REPEAT TPR DOMAIN RECEPTOR NUCLEAR CELL TRANSFERASE DIVISION MITOCHONDRIAL.

Paralogs:  Local Blast Search
Weak evidence of paralogy: residues 108-239 are 28% similar to CPn1021; residues 29-291 are 20% similar to CPn0287; and residues 25-274 are 20% similar to CPn0840.

Pfam Summary:  Pfam Search
Residues 111 to 144 (E-value = 3.1e-09) place CPn0693 in the TPR family which is described as TPR Domain (PF00515)
Residues 179 to 212 (E-value = 2.8e-06) place CPn0693 in the TPR family which is described as TPR Domain (PF00515)
Residues 213 to 246 (E-value = 9.9e-07) place CPn0693 in the TPR family which is described as TPR Domain (PF00515)
Residues 247 to 280 (E-value = 3.6e-05) place CPn0693 in the TPR family which is described as TPR Domain (PF00515)

PDB Hit:


Gene Protein Sequence:
MEEAAKHLAKEFLCSGINLFLSGEYEQAEKRLKETLELDSTAALAYCYLG
IIALETGRVSEALNWCSKGLASEPGDSYLRYCYGVALDRGNQYEAAIEQY
SAYVALHPDDVECWFSLGSVYHRLKRLQEALDCFDKILALDPWNPQSLYN
KAVILSEMDDEAESIRLLEVAVAKNPLYWKAWVKLGFLLSRSKRWDKATE
AYERVVQLRPDLSDGHYNLGLCYLTLDKTRLALKAFQEALFLNAEDADAH
FYVGLAHLDLKQMREAYEAFNSALSINLEHERAHYLLGYLHHMQGETDKA
TKELLFLQKKDSTFAPLLQKTVVSDPSSMQFERRLDTIS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAGAAGCTGCGAAACACTTGGCAAAAGAATTTCTGTGTTCAGGAAT
TAACCTTTTTTTGAGCGGTGAATATGAGCAAGCGGAAAAAAGACTGAAAG
AAACCTTAGAATTAGACTCTACAGCAGCACTCGCTTATTGTTATTTAGGG
ATTATTGCTTTAGAGACTGGAAGAGTCTCCGAGGCTTTGAACTGGTGTTC
TAAAGGTTTAGCATCCGAGCCGGGAGACAGCTATCTCCGTTATTGTTATG
GTGTAGCGTTAGACCGGGGGAATCAATATGAAGCAGCTATCGAACAGTAT
AGTGCGTATGTTGCTTTGCATCCCGATGATGTTGAGTGCTGGTTTAGTCT
TGGAAGTGTATATCATCGTTTGAAGAGACTTCAAGAGGCTTTAGATTGTT
TTGATAAGATCCTTGCACTTGATCCTTGGAATCCACAAAGTTTATATAAT
AAGGCAGTGATCCTTTCTGAAATGGACGATGAAGCGGAGTCCATTCGTTT
GCTTGAAGTTGCTGTAGCGAAGAATCCCTTATATTGGAAAGCTTGGGTAA
AGTTAGGTTTTTTGCTTTCTCGAAGCAAACGATGGGACAAGGCTACTGAG
GCTTATGAACGTGTTGTTCAGCTGCGACCTGATTTGTCTGATGGTCATTA
CAATTTAGGTTTATGTTATCTCACTTTAGATAAAACTCGATTAGCTTTGA
AGGCTTTTCAAGAAGCGTTGTTTCTCAATGCTGAAGATGCTGATGCACAT
TTTTATGTCGGACTTGCTCACTTGGATCTTAAGCAAATGCGGGAAGCGTA
TGAGGCTTTTAATAGCGCGTTGTCTATTAATTTAGAACATGAGCGCGCTC
ACTATCTTCTGGGCTATTTGCATCATATGCAAGGAGAGACCGATAAGGCA
ACAAAAGAGCTTTTATTTTTGCAAAAAAAGGATTCTACGTTTGCTCCCTT
ATTGCAGAAGACTGTGGTGTCAGATCCCTCCTCAATGCAATTTGAAAGGC
GTTTAGATACTATTTCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy