Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR549 IGR550 IGR548 IGR547 IGR552 IGR546 IGR551 abcX, - CPn0691 CPn0693 yfhO,nifS, - CPn0689 CPn0690 CPn0692 pbpB, - CPn0694 CPn0687 CPn0688 abcX, - CPn0691 CPn0693 yfhO,nifS, - CPn0689 CPn0690 CPn0692 pbpB, - CPn0694 CPn0687 CPn0688 abcX, - CPn0691 CPn0693 yfhO,nifS, - CPn0689 CPn0690 CPn0692 pbpB, - CPn0694 CPn0688 CPn0687
* Calculated from Protein Sequence

Gene ID: CPn0692

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (possible ABC transporter associated protein)

Gene Start:
774912

Gene Stop:
773458

Gene Length:
1455

Molecular Weight*:
53750

pI*:
6.20

Net Charge*:
-5.64

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to conserved hypothetical protein sequences; e.g. residues 1-484 are 76% similar to CT684; residues 30-484 are 34% similar to TP0612; residues 288-452 are 24% similar to TP0613; residues 13-484 are 62% similar to Y074_SYNY3; residues 13-484 are 60% similar to YC24_CYAPA; residues 13-484 are 58% similar to YC24_PORPU; and residues 13-484 are 59% similar to (AF041468) ABC transporter [Guillardia theta].
No significant similarity to M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0719
COG name: Predicted membrane components of an uncharacterized iron-regulated ABC-type transporter SufB
Functional Class:  R
The phylogenetic pattern of COG0719 is amtK--VCEBR------LIN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 30-55, 178-189, 315-339, and 398-452 represent blocks PF01458A-D (Uncharacterized protein family (UPF0051)) with a combined E-value of 3.7e-50.

ProDom Summary:  Protein Domain Search
Residues 193-458 are 67% similar to a defined domain of Y074_SYNY3, defined as: PROTEIN YCF24 REGION LONG SPLICE MTV007.08 CHLOROPLAST LPP-AROD INTERGENIC ABC.
Residues 30-121 are 58% similar to a defined domain of Y074_SYNY3, defined as: PROTEIN YCF24 CHLOROPLAST YURU INTEIN MLCL536.28C B1496_C2_189 SPLICING SPLICE MTV007.08.

Paralogs:  Local Blast Search
CPn0690 is a possible paralog. Residues 131-458 are 21% similar to CPn0690.

Pfam Summary:  Pfam Search
Residues 214 to 455 (E-value = 1.6e-114) place CPn0692 in the UPF0051 family which is described as Uncharacterized protein family (UPF0051) (PF01458)

PDB Hit:


Gene Protein Sequence:
MGESVKVFLEEREDYPYGFVTPIESQGLTRGLSEETIEEIAALRNEPQFI
IDFRLQAYRYWKQLHEPAWARLHYGPIAYDDIVYFSSPKQKKPLGRLEDA
DPEILDTFKKLGIPLDEQKRLLNVENVAVDLVFDSVSIGTTFKEALEKAG
VIFCSLGEAIQEHPNLVKKYLGSVVSHRDNFFAALNAAVFSDGSFVYVPK
GVKCPMDISTYFRINNKEAGQFERTLIVVEDGGYASYLEGCTAPAYSSNQ
LHAAVVELVAHEHAVIRYSTVQNWYAGDKKTGKGGIYNFVTKRGLCAGYR
SKISWSQVEVGAAITWKYPSCILKGDESVGEFYSVALTSGKMQADTGTKM
LHVGKRTTSTVISKGISSDESKNTFRSLVSLGKKAEHSSNYTQCDSMLIG
KASGAYTDPKIVVENSTSSIEHEATTSKLREDQLLYLRSRGLSPEEAVSL
VIHGFCREIIEQLPLEFAQEASKLLLIKLENSVG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGCGAATCAGTAAAGGTTTTTTTAGAAGAGCGTGAGGACTATCCTTA
CGGTTTTGTGACTCCTATAGAGTCTCAAGGATTGACGCGAGGACTTAGTG
AAGAGACAATCGAAGAAATCGCTGCTCTACGTAATGAACCTCAGTTTATT
ATAGATTTTCGTTTACAAGCATACCGTTATTGGAAGCAGTTGCATGAGCC
AGCCTGGGCACGCCTGCATTATGGTCCTATAGCCTATGATGATATAGTCT
ATTTTTCATCTCCTAAGCAGAAAAAACCTCTTGGACGTTTAGAAGATGCC
GATCCAGAAATTTTAGATACGTTCAAAAAATTAGGTATACCTTTAGATGA
GCAGAAGCGCTTACTAAATGTCGAGAATGTTGCTGTAGATTTAGTTTTTG
ACTCGGTCTCTATTGGAACCACATTTAAAGAAGCGTTGGAAAAGGCCGGA
GTTATTTTCTGTTCTTTGGGCGAAGCGATTCAAGAACATCCGAATTTGGT
AAAAAAATATTTAGGCTCCGTTGTTTCGCATCGGGATAATTTCTTTGCTG
CTTTGAATGCGGCTGTTTTTAGTGACGGCTCTTTTGTTTATGTTCCTAAA
GGGGTGAAATGTCCTATGGATATTTCTACCTATTTTCGGATTAATAACAA
GGAAGCGGGTCAATTTGAGCGTACTCTCATTGTTGTGGAGGATGGCGGCT
ATGCGAGTTATCTTGAGGGGTGTACGGCGCCGGCATACTCTTCTAATCAG
CTACATGCTGCGGTTGTTGAATTGGTGGCTCATGAGCATGCGGTCATAAG
GTATTCCACGGTGCAAAATTGGTATGCTGGTGATAAGAAAACAGGGAAAG
GCGGCATTTATAATTTTGTAACAAAACGAGGTCTGTGCGCAGGCTATCGT
TCTAAGATCTCCTGGTCACAGGTTGAGGTTGGTGCTGCAATTACATGGAA
ATACCCTAGTTGTATTTTAAAGGGCGACGAGAGTGTTGGAGAATTTTATT
CTGTAGCTCTTACTAGTGGGAAAATGCAGGCCGACACAGGCACCAAAATG
CTACACGTAGGGAAACGCACCACATCCACGGTGATCTCTAAGGGAATTTC
TTCTGACGAGTCTAAGAACACGTTTAGAAGTTTGGTCTCCTTAGGGAAAA
AGGCTGAACATAGTAGTAACTATACGCAATGCGACTCCATGTTGATAGGC
AAGGCTTCCGGAGCCTATACGGATCCGAAGATTGTAGTAGAAAATTCAAC
ATCTTCAATTGAGCATGAAGCCACGACCTCAAAATTACGTGAGGATCAGT
TATTGTATTTACGTAGTCGTGGACTGAGTCCTGAGGAAGCAGTCAGCTTA
GTGATCCATGGTTTTTGTCGGGAAATTATAGAACAATTACCTTTAGAATT
TGCTCAGGAAGCATCGAAGTTATTGTTAATTAAATTAGAAAATAGCGTGG
GTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy