Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR549 IGR550 IGR548 IGR544 IGR547 IGR552 IGR546 IGR545 IGR551 CPn0686 abcX, - CPn0691 CPn0693 yfhO,nifS, - CPn0689 CPn0690 CPn0692 pbpB, - CPn0694 CPn0685 CPn0687 CPn0688 CPn0686 abcX, - CPn0691 CPn0693 yfhO,nifS, - CPn0689 CPn0690 CPn0692 pbpB, - CPn0694 CPn0685 CPn0687 CPn0688 CPn0686 abcX, - CPn0691 CPn0693 yfhO,nifS, - CPn0689 CPn0690 CPn0692 pbpB, - CPn0694 CPn0687 CPn0688 CPn0685
* Calculated from Protein Sequence

Gene ID: CPn0691

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
abcX  

Definition:
ABC transporter ATPAse

Gene Start:
773452

Gene Stop:
772682

Gene Length:
771

Molecular Weight*:
28640

pI*:
5.10

Net Charge*:
-8.49

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to ABC transporter, ATP-binding protein sequences; e.g. residues 1-249 are 57% similar to CT685; residues 1-248 are 40% similar to TP0611; residues 16-249 are 24% similar to MG065; residues 16-209 are 26% similar to TP0786; residues 1-246 are 47% similar to ABCX_PORPU; residues 1-247 are 42% similar to ABCX_ODOSI; and residues 1-246 are 46% similar to ABCX_CYAPA.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0396
COG name: Iron-regulated ABC transporter ATPase subunit SufC
Functional Class:  R
The phylogenetic pattern of COG0396 is amtK--Vcebr------lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 32-43 and 149-180 represent blocks BL00211A-B (ABC transporters family proteins) with a combined E-value of 3.5e-20.

ProDom Summary:  Protein Domain Search
Residues 72-148 are 44% similar to a defined domain of ABCX_ANTSP, defined as: ATP-DEPENDENT TRANSPORTER ATP-BINDING TRANSPORT PROBABLE YCF16 PROTEIN CHLOROPLAST CYANELLE SLR0075.
Residues 17-69 are 54% similar to a defined domain of ABCX_CYACA, defined as: ATP-BINDING TRANSPORT PROTEIN TRANSPORTER ABC TRANSMEMBRANE MEMBRANE INNER RESISTANCE GLYCOPROTEIN.

Paralogs:  Local Blast Search
Several possible paralogs found in C.pneumoniae; CPn0723, CPn0231, CPn0201, CPn0202, CPn0023, CPn0248, CPn0191, and CPn0542. Residues 1-238 are 26% similar to CPn0723.

Pfam Summary:  Pfam Search
Residues 27 to 227 (E-value = 1.4e-29) place CPn0691 in the ABC_tran family which is described as ABC transporter (PF00005)

PDB Hit:


Gene Protein Sequence:
MLKIKHLHASCNDVKILDDFNLNIQPGTMHVIMGPNGAGKSTLAKILAGD
ESVLVSSGEIALQEQNLLSMLPEERSRAGLFVGFQMPPEIPGVNNKMFLR
DAYNARRRANQEGDISIDEFNTLLSTVLETYEYNATTDLFLDRNVNEGFS
GGERKRNEICQMLVLEPEMVLLDEPDSGLDVDALRLICRVLEKYRELHPT
SSLCIVTHNPKLGNLIRPDVVHLLLDGRVALSGDVSLMHELEAKSYQEVT
KRVAWR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAAAAATAAAGCACTTACATGCTAGCTGTAATGATGTGAAGATTCT
GGATGATTTCAATTTGAATATCCAACCTGGAACTATGCATGTCATTATGG
GACCTAATGGGGCAGGAAAATCGACTCTTGCTAAAATTTTAGCGGGAGAT
GAGAGTGTCTTGGTATCTTCGGGTGAGATTGCATTACAGGAGCAAAATTT
GCTTTCTATGTTGCCAGAAGAGCGTTCCCGAGCAGGGCTATTTGTTGGTT
TTCAAATGCCTCCAGAGATTCCTGGAGTCAATAACAAGATGTTTTTGCGA
GACGCCTATAATGCCCGCCGTCGTGCGAATCAAGAGGGAGATATTTCTAT
TGATGAGTTTAATACTCTGCTTTCGACTGTATTAGAGACATATGAGTATA
ACGCGACTACAGATCTATTTTTAGATAGGAATGTCAACGAGGGTTTTTCT
GGAGGAGAAAGAAAGCGCAATGAGATTTGCCAGATGCTAGTTTTAGAACC
CGAAATGGTCTTACTAGATGAACCTGATTCTGGTTTGGATGTAGATGCAT
TACGTTTGATTTGTAGAGTCTTGGAGAAATACCGAGAGTTACATCCTACC
AGTTCCTTATGCATTGTGACTCACAACCCCAAATTAGGAAACCTCATTCG
CCCTGATGTTGTTCATCTTTTATTAGATGGTCGAGTAGCGCTTTCAGGAG
ACGTTTCTTTGATGCATGAATTAGAAGCAAAAAGCTACCAAGAGGTGACT
AAGCGTGTTGCGTGGAGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy