Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR549 IGR550 IGR548 IGR544 IGR547 IGR552 IGR546 IGR545 IGR543 IGR551 CPn0686 abcX, - CPn0691 spoJ,parB, - CPn0684 CPn0693 yfhO,nifS, - CPn0689 CPn0690 CPn0692 pbpB, - CPn0694 CPn0685 CPn0687 CPn0688 CPn0686 abcX, - CPn0691 spoJ,parB, - CPn0684 CPn0693 yfhO,nifS, - CPn0689 CPn0690 CPn0692 pbpB, - CPn0694 CPn0685 CPn0687 CPn0688 CPn0686 abcX, - CPn0691 spoJ,parB, - CPn0684 CPn0693 yfhO,nifS, - CPn0689 CPn0690 CPn0692 pbpB, - CPn0694 CPn0685 CPn0687 CPn0688
* Calculated from Protein Sequence

Gene ID: CPn0690

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (possible ABC transporter related membrane protein)

Gene Start:
772680

Gene Stop:
771433

Gene Length:
1248

Molecular Weight*:
45762

pI*:
4.80

Net Charge*:
-18.12

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to hypothetical protein sequences and ABC transporter sequences; e.g. residues 25-395 are 37% similar to CT686, a conserved hypothetical protein (possible ABC transporter related membrane protein); residues 292-396 are 28% similar to TP0612, a conserved hypothetical protein; residues 311-397 are 32% similar to CT684, a conserved hypothetical protein (possible ABC transporter associated protein); and residues 283-394 are 39% similar to YNHC_ECOLI.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0719
COG name: Predicted membrane components of an uncharacterized iron-regulated ABC-type transporter SufB
Functional Class:  R
The phylogenetic pattern of COG0719 is amtK--VCEBR------LIN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 337-391 represent block PF01458D (Uncharacterized protein family (UPF0051)) with an E-value of 4.7e-17.

ProDom Summary:  Protein Domain Search
Residues 283-394 are 40% similar to a defined domain of YNHC_ECOLI, defined as: PROTEIN YCF24 REGION LONG SPLICE MTV007.08 CHLOROPLAST LPP-AROD INTERGENIC ABC.

Paralogs:  Local Blast Search
CPn0692, a predicted ABC transporter, is a probable paralog. Residues 75-397 are 21% similar to CPn0692.

Pfam Summary:  Pfam Search
Residues 160 to 394 (E-value = 7.5e-16) place CPn0690 in the UPF0051 family which is described as Uncharacterized protein family (UPF0051) (PF01458)

PDB Hit:


Gene Protein Sequence:
VLVSIETFSSIASGSPVQKAAEACYTQYSKQPSSKEVLSSFSWIQELSLF
PDRYNLATGASELIKQHWLHNNHSLAFECILINGKYEPSLSQLPEGVIVC
GIDEARGSLSSFMQGFDVNKHPLAFLNAVCSEDRGVVIYIPEEMQTSDPI
FVRHISFPTVSDHDVIFSPRIVVILGQRASAQIQISHDVDLEMVGSSKTI
VNGVTELFVGEGADLTVFMVPGYSEEDTLSWSTIATVEKDAICRMTQNLL
ESCQGFGWFDNTSYIVGKKGHAESLVLVQSPRKTWVNNLMSHDAEETVSR
QNIKSILYSGHFLFEGTISISSQGDLSDANQKHDTLLLSSEARVSTFPRL
EIETDEVKASHGATVGPLDPQQIFYMRSRGMTEAEAQEKLIHGFLKQGLV
SDTFLGSSFQLNQTS$

Gene Nucleotide Sequence:  Sequence Viewer
GTGTTAGTTTCAATAGAGACATTTTCTTCTATTGCTTCGGGTTCTCCTGT
GCAAAAAGCTGCGGAAGCTTGCTACACTCAATATAGCAAGCAGCCTTCTT
CAAAAGAGGTGCTTAGTAGCTTTTCTTGGATTCAGGAGCTTTCTCTTTTT
CCTGATCGCTATAATCTTGCGACTGGAGCTTCAGAACTAATTAAGCAACA
TTGGCTACACAATAACCATTCTTTAGCCTTTGAGTGTATTTTAATTAATG
GAAAATACGAACCTTCGTTATCCCAGTTGCCTGAGGGGGTGATTGTCTGT
GGTATAGACGAAGCTAGGGGATCATTGTCTTCATTCATGCAAGGGTTTGA
TGTAAATAAGCATCCCTTAGCATTTTTAAATGCTGTTTGTTCTGAAGATC
GGGGTGTAGTGATTTACATTCCTGAAGAGATGCAGACGAGCGATCCTATT
TTTGTACGTCATATTAGTTTTCCTACAGTTTCGGATCATGATGTGATTTT
CTCTCCTAGGATCGTCGTTATTTTAGGACAACGGGCGTCCGCTCAAATAC
AAATATCACATGATGTTGATTTAGAGATGGTGGGTTCTAGTAAAACTATA
GTCAATGGGGTTACCGAGCTCTTCGTTGGAGAAGGGGCGGATCTTACAGT
GTTTATGGTTCCAGGATATTCTGAAGAGGATACCTTGAGTTGGTCCACTA
TTGCGACGGTTGAGAAAGATGCTATCTGCAGGATGACTCAGAATTTGCTT
GAAAGTTGTCAAGGTTTCGGATGGTTTGACAATACGAGCTACATAGTCGG
GAAGAAGGGACACGCAGAATCTCTAGTGTTAGTCCAATCGCCAAGAAAAA
CTTGGGTCAATAATTTAATGTCTCACGATGCTGAAGAGACGGTATCGCGT
CAGAATATTAAATCGATTTTATATTCAGGGCATTTTCTATTTGAAGGGAC
AATTTCTATTTCTTCTCAAGGAGACTTGTCGGATGCGAATCAAAAGCATG
ATACGTTGTTATTAAGTTCAGAAGCTCGTGTATCTACATTTCCACGTTTA
GAGATAGAAACAGACGAGGTGAAGGCATCCCACGGCGCTACAGTAGGACC
TTTAGATCCTCAGCAGATCTTTTACATGCGTTCTCGAGGCATGACAGAGG
CAGAGGCTCAGGAAAAACTCATACATGGGTTCCTAAAACAAGGATTAGTT
TCCGATACGTTTTTGGGATCTTCTTTTCAGCTAAATCAAACCTCCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy