Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR549 IGR550 IGR548 IGR544 IGR547 IGR546 IGR545 IGR543 IGR551 CPn0686 abcX, - CPn0691 spoJ,parB, - CPn0684 CPn0693 yfhO,nifS, - CPn0689 CPn0690 CPn0692 CPn0685 CPn0687 CPn0688 dppD, - CPn0682 CPn0686 abcX, - CPn0691 spoJ,parB, - CPn0684 CPn0693 yfhO,nifS, - CPn0689 CPn0690 CPn0692 CPn0685 CPn0687 CPn0688 dppD, - CPn0682 CPn0686 abcX, - CPn0691 spoJ,parB, - CPn0684 CPn0693 yfhO,nifS, - CPn0689 CPn0690 CPn0692 CPn0685 CPn0687 CPn0688 dppF, - CPn0683 dppF, - CPn0683 dppD, - CPn0682
* Calculated from Protein Sequence

Gene ID: CPn0689

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yfhO  nifS  

Definition:
NifS-related protein (aminotransferase)

Gene Start:
771404

Gene Stop:
770184

Gene Length:
1221

Molecular Weight*:
44556

pI*:
5.00

Net Charge*:
-14.23

EC:
 

Functional Class:
uncategorized  

Pathway: pathway table

Comment:
See CPn0396, CPn0862.

Blast Summary:  PSI-Blast Search
CPn0689 is orthologously related to CT687: residues 3-405 of CPn0689 are 57% similar to residues 3-400 of CT687, a predicted NifS-related protein (aminotransferase) from C. trachomatis.
CPn0689 is also similar to TP0614, UU454, MG336, all predicted nifS-like proteins.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0520
COG name: Selenocysteine lyase
Functional Class:  E
The phylogenetic pattern of COG0520 is --t---vcEbrhujgpolin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 30 to 393 (E-value = 5e-18) place CPn0689 in the Aminotran_5 family which is described as Aminotransferase class-V (PF00266)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
93
non-globular  
260  
356

PDB Hit:


Gene Protein Sequence:
VKNLKEDFPIFAAKAKENEPFIYLDSAATTQKPQQVIDAVANFYTSSYAT
VNRAIYSSSRNVTEAYAAVREKVRKWVSAASDSEIVFTRGTTAGLNLLAI
SVNDLWIPKGGVVLVSEAEHHANVLSWEIACRRRGSLVKKIRVHDSGLID
LDDLEKLLNEGAQFVSIPHVSNVTGCVQPLQQVAELVHRYDAYLAVDGAQ
GAPHLPIDVQLWDVDFYVFSSHKIYGPTGIGVLYGKKDLLDQLPPVEGGG
DMVAIYDHQNPEYLPAPMKFEAGTPNIAGVLGLGAALDYLDGLSAKFIYD
KEIALTTYLHKELLEIPGVEILGPSIEEPRGALIGMTIDGAHPLDLGFLL
DLRGIAVRTGHQCAQPAMERWNVGHVLRVSLGIYNDEDDIDQFILVLQDS
LDKIRR$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAAGAATTTAAAAGAAGATTTTCCGATTTTTGCTGCTAAAGCAAAAGA
GAACGAGCCTTTTATTTATTTAGATTCAGCTGCAACGACTCAGAAACCTC
AACAGGTGATAGATGCCGTTGCTAACTTTTATACTTCTTCATATGCAACT
GTAAATCGTGCGATTTATAGTTCCTCTAGGAACGTCACGGAAGCATACGC
AGCTGTTCGCGAAAAAGTGCGTAAGTGGGTATCCGCAGCCTCTGATAGTG
AAATCGTATTCACCCGTGGGACAACTGCAGGGTTAAATTTATTAGCCATT
TCTGTTAATGACCTCTGGATCCCTAAGGGGGGTGTTGTTCTGGTTTCTGA
GGCAGAACACCATGCGAATGTTTTATCTTGGGAGATTGCCTGTCGGCGGC
GAGGTTCTTTAGTAAAAAAGATCAGAGTTCATGATTCAGGGCTTATAGAT
CTTGATGATTTGGAAAAGCTTCTAAATGAAGGTGCTCAATTTGTAAGCAT
TCCTCATGTGAGTAATGTTACGGGTTGTGTCCAACCTCTCCAACAAGTTG
CTGAGCTTGTCCACCGCTATGACGCTTACCTTGCTGTTGATGGTGCTCAG
GGAGCTCCTCATCTTCCTATAGACGTTCAGCTTTGGGATGTAGATTTCTA
TGTGTTTTCGTCACATAAGATTTATGGACCCACGGGCATAGGAGTCTTAT
ATGGGAAAAAAGATCTATTAGATCAGTTGCCTCCAGTAGAAGGAGGTGGT
GATATGGTTGCTATCTACGATCATCAGAATCCTGAATATCTTCCTGCACC
TATGAAATTTGAAGCTGGGACTCCAAATATTGCTGGAGTTTTAGGCTTAG
GGGCTGCTTTAGATTATCTCGATGGCTTGTCAGCTAAGTTTATCTACGAC
AAAGAGATTGCCCTAACTACATATTTACATAAAGAGCTGCTTGAGATTCC
AGGTGTAGAGATTCTCGGACCTTCTATAGAGGAACCCAGGGGAGCTCTTA
TAGGCATGACAATCGATGGAGCCCATCCTTTGGATCTAGGTTTTTTATTA
GATCTTAGAGGAATTGCTGTGCGGACGGGTCATCAATGTGCCCAACCTGC
TATGGAGCGATGGAATGTGGGTCATGTGTTGAGAGTGTCCTTAGGAATCT
ATAATGATGAGGATGATATCGATCAATTCATCCTTGTTTTGCAGGATTCT
TTAGATAAGATTCGTAGATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy