Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR549 IGR550 IGR548 IGR544 IGR547 IGR542 IGR546 IGR545 IGR543 CPn0686 CPn0681 abcX, - CPn0691 spoJ,parB, - CPn0684 yfhO,nifS, - CPn0689 CPn0690 CPn0692 CPn0685 CPn0687 CPn0688 dppD, - CPn0682 CPn0686 CPn0681 abcX, - CPn0691 spoJ,parB, - CPn0684 yfhO,nifS, - CPn0689 CPn0690 CPn0692 CPn0685 CPn0687 CPn0688 dppD, - CPn0682 CPn0686 CPn0681 abcX, - CPn0691 spoJ,parB, - CPn0684 yfhO,nifS, - CPn0689 CPn0690 CPn0692 CPn0685 CPn0687 CPn0688 dppD, - CPn0682 dppF, - CPn0683 dppF, - CPn0683
* Calculated from Protein Sequence

Gene ID: CPn0688

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
769382

Gene Stop:
770140

Gene Length:
759

Molecular Weight*:
29336

pI*:
10.60

Net Charge*:
17.77

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0688 is orthologously related to CT481: residues 1-240 of CPn0688 are 47% similar to residues 1-240 of CT481, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 41 to 194 (E-value = 7.5e-21) place CPn0688 in the Polysacc_deac_1 family which is described as Polysaccharide deacetylase (PF01522)

PDB Hit:


Gene Protein Sequence:
MLIVLAFRQVFFSHSRSQLDRLKNYLRLLKQNFAITLPKERTSKGHSLML
TFDFASFDFYTNIFPFLEEQKIPAVVGVASRYIPSNAAQDLHPSHRLKPS
ETLAFQDEIFSNYMPFCCQNELIEMAKSPYIQLASSGFAIRNLMNNPPYL
TTEILLSRHHIETITGAKPLAFLFPFGKSDPTSRKLAADHYPYSFLLGNT
INRKLKTHNIYRLDIKPMQYVCPSLFQSSRYLKNWIKEKSKQLYLKKQLP
KR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCATAGTTCTTGCTTTCCGACAGGTCTTTTTTTCCCACTCTCGTTC
CCAGTTAGACCGTCTAAAAAATTACCTACGGCTCCTAAAACAAAACTTTG
CTATTACCCTCCCCAAAGAACGAACCTCAAAAGGACATTCGCTAATGCTC
ACTTTTGACTTCGCCTCCTTTGACTTCTATACAAATATCTTTCCCTTCCT
TGAGGAACAAAAGATTCCTGCTGTTGTAGGGGTAGCTTCCCGATATATTC
CATCAAATGCTGCTCAAGACCTTCACCCTTCACATCGTTTAAAACCCTCT
GAAACTCTAGCATTCCAAGACGAGATCTTCTCTAACTACATGCCCTTTTG
TTGCCAAAATGAACTGATAGAAATGGCAAAGTCTCCCTATATCCAATTAG
CATCCTCAGGATTCGCAATTCGGAATCTCATGAATAATCCTCCGTATCTC
ACTACAGAAATTTTACTTTCGCGACATCACATAGAAACAATAACAGGAGC
CAAGCCCTTGGCATTCCTCTTCCCCTTCGGGAAGTCAGATCCTACAAGCC
GGAAGCTTGCTGCAGATCACTACCCCTATTCTTTCCTGTTAGGGAATACC
ATTAACAGAAAATTAAAAACTCATAACATCTACCGCTTAGACATAAAACC
TATGCAGTACGTCTGCCCGAGTTTATTTCAGAGCTCTAGGTATTTAAAAA
ACTGGATTAAAGAGAAAAGTAAACAGCTGTATCTCAAAAAACAACTTCCA
AAAAGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy