Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR549 IGR550 IGR541 IGR548 IGR544 IGR547 IGR542 IGR546 IGR545 IGR543 CPn0686 CPn0681 abcX, - CPn0691 spoJ,parB, - CPn0684 yfhO,nifS, - CPn0689 CPn0690 ygo4, - CPn0680 CPn0692 CPn0685 CPn0687 CPn0688 dppD, - CPn0682 CPn0686 CPn0681 abcX, - CPn0691 spoJ,parB, - CPn0684 yfhO,nifS, - CPn0689 CPn0690 ygo4, - CPn0680 CPn0692 CPn0685 CPn0687 CPn0688 dppD, - CPn0682 CPn0686 spoJ,parB, - CPn0684 yfhO,nifS, - CPn0689 CPn0690 ygo4, - CPn0680 CPn0692 CPn0681 abcX, - CPn0691 CPn0685 CPn0687 CPn0688 dppD, - CPn0682 dppF, - CPn0683 dppF, - CPn0683
* Calculated from Protein Sequence

Gene ID: CPn0687

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
768564

Gene Stop:
769217

Gene Length:
654

Molecular Weight*:
24375

pI*:
9.90

Net Charge*:
7.58

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0687 is similar to CT482: residues 10-213 of CPn0687 are 50% similar to residues 7-210 of CT482, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
35

PDB Hit:


Gene Protein Sequence:
MQKLVHNIWKKFYSFSSAIAICIVLASFLSLKIVSNTYKHSQAKRNSILL
LTRAAEVAVSQGFLPSKSALSSLEQAYHLGGESMKPYAGFLASCFYIHNE
PLRGAYYAGLAYNNSQALQLPHPIQKLLKEISEAQADQLYDVALSKSYQL
LQTANSSPEYPTLSFLTLLRVIELKELLHQDVSQDFAALKSSPLFHQFER
MYSDGEWTLSKRFGKKG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAAAGCTAGTCCATAATATTTGGAAAAAATTTTATTCTTTTTCTTC
GGCAATTGCCATTTGTATCGTTCTTGCGTCCTTCCTATCCCTAAAGATTG
TTTCTAACACGTATAAACATTCCCAAGCCAAACGTAATAGCATTCTTCTA
CTTACGAGAGCAGCTGAAGTCGCTGTTTCTCAAGGATTCCTTCCATCTAA
ATCTGCCTTGTCGTCATTGGAACAAGCCTATCATCTTGGAGGAGAATCCA
TGAAGCCCTATGCAGGGTTTTTAGCTTCGTGCTTCTATATTCATAATGAG
CCTTTACGTGGAGCCTACTACGCAGGACTCGCTTATAACAATAGTCAAGC
ACTGCAGCTGCCCCACCCCATTCAAAAACTCCTCAAGGAAATTTCAGAAG
CACAAGCTGATCAATTGTATGATGTTGCTTTAAGTAAATCCTATCAGCTC
TTACAAACTGCTAACAGCTCTCCTGAATATCCTACTCTATCTTTTTTAAC
CCTACTACGTGTGATCGAACTCAAAGAACTCCTCCACCAAGATGTAAGTC
AAGACTTTGCAGCATTGAAAAGCTCCCCCCTATTTCACCAATTTGAACGC
ATGTATAGCGATGGAGAATGGACATTAAGCAAACGTTTTGGCAAAAAAGG
ATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy