Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR549 IGR541 IGR548 IGR544 IGR547 IGR542 IGR546 IGR545 IGR543 CPn0686 CPn0681 abcX, - CPn0691 spoJ,parB, - CPn0684 yfhO,nifS, - CPn0689 CPn0690 ygo4, - CPn0680 CPn0685 CPn0687 CPn0688 dppD, - CPn0682 CPn0686 CPn0681 abcX, - CPn0691 spoJ,parB, - CPn0684 yfhO,nifS, - CPn0689 CPn0690 ygo4, - CPn0680 CPn0685 CPn0687 CPn0688 dppD, - CPn0682 CPn0686 CPn0681 abcX, - CPn0691 spoJ,parB, - CPn0684 yfhO,nifS, - CPn0689 CPn0690 ygo4, - CPn0680 CPn0685 CPn0687 CPn0688 dppD, - CPn0682 dppF, - CPn0683 dppF, - CPn0683
* Calculated from Protein Sequence

Gene ID: CPn0685

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
768068

Gene Stop:
768220

Gene Length:
153

Molecular Weight*:
5924

pI*:
7.80

Net Charge*:
0.70

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any other known sequences.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
LDLQAFEILDVQGMLTDQRKHIQMLHKHNSIEIFLSNMVVEVKLFFKTLK
$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGATTTGCAAGCATTTGAAATCCTGGACGTACAGGGAATGCTTACAGA
TCAACGTAAGCATATCCAAATGCTGCATAAACATAACAGCATTGAAATTT
TTCTATCAAACATGGTTGTAGAAGTGAAGCTCTTTTTTAAAACCCTTAAG
TAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy