Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR541 IGR548 IGR544 IGR540 IGR547 IGR542 IGR546 IGR545 IGR543 CPn0686 CPn0681 spoJ,parB, - CPn0684 pgk, - CPn0679 yfhO,nifS, - CPn0689 CPn0690 ygo4, - CPn0680 CPn0685 CPn0687 CPn0688 dppF, - CPn0683 CPn0686 CPn0681 spoJ,parB, - CPn0684 pgk, - CPn0679 yfhO,nifS, - CPn0689 CPn0690 ygo4, - CPn0680 CPn0685 CPn0687 CPn0688 dppF, - CPn0683 CPn0686 CPn0681 spoJ,parB, - CPn0684 pgk, - CPn0679 yfhO,nifS, - CPn0689 CPn0690 ygo4, - CPn0680 CPn0685 CPn0687 CPn0688 dppF, - CPn0683 dppD, - CPn0682 dppD, - CPn0682
* Calculated from Protein Sequence

Gene ID: CPn0684

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
spoJ  parB  

Definition:
stage 0 sporulation protein J (spoOJ)

Gene Start:
768038

Gene Stop:
767178

Gene Length:
861

Molecular Weight*:
32011

pI*:
6.50

Net Charge*:
-2.15

EC:
 

Functional Class:
cellular processes; cell division  

Pathway: pathway table

Comment:
This protein appears to be required for sporulation and normal chromosome segregation. It antogonizes inhibition by SOJ.
See CT688.

Blast Summary:  PSI-Blast Search
CPn0684 is similar to CT688, a predicted sporulation protein. Residues 6-277 are 61% similar to CT688. Residues 18-278 are 32% similar to TP0271, a predicted chromosome partitioning protein. Residues 4-276 are 33% similar to SPOJ_BACSU. No significant similarity to M.genitalium, U.urealyticum, or M.pneumoniae.

COGS Summary:  COGS Search
BeTs to 9 clades of COG1475
COG name: Predicted transcriptional regulators
Functional Class:  K
The phylogenetic pattern of COG1475 is amtK-Q--eBr-uj--Olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 32-53, 63-87, and 104-117 represent blocks BP02248A-C (PROTEIN PLASMID REPB REPRESSOR DNA-BINDING REPLICATION) with a combined E-value of 5.8e-23.

ProDom Summary:  Protein Domain Search
Residues 102-255 are 41% similar to YGI2_PSEPU, defined as: PROTEIN SPORULATION STAGE J DNA-BINDING PLASMID INTERGENIC REGION CHROMOSOME PARTITIONING.
Residues 13-91 are 45% similar to O06671_STRPN, defined as: PROTEIN PLASMID REPB REPRESSOR DNA-BINDING REPLICATION KORB DNA INTERGENIC REGION.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 11 to 106 (E-value = 1.3e-37) place CPn0684 in the ParBc family which is described as ParB-like nuclease domain (PF02195)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
149  
242

PDB Hit:


Gene Protein Sequence:
VTEEISKDTIIEVAIDDIRVSPFQPRRVFSNEELQELIASIKAVGLIHPP
VVREICTGDRVLYYELIAGERRWRAMQLAGATTIPVILKHVIADGTAAEA
TLIENIQRVNLNPIEMAEAFKRLIHVFGLTQDKVAYKVGKKRSTVANYLR
LLALSKTIQESLLQGQITLGHAKVILTLEDPILREKLNEIIIQEHLAVRE
AELIAKQLISEEGSSIELKPTPLDMAESSKQHEELQQRLSDLCGYKVQIK
TRGSKATVSFHLQNTQDLQKLEAWLSSHGTLSESLS$

Gene Nucleotide Sequence:  Sequence Viewer
GTGACTGAGGAAATCAGTAAGGATACAATTATAGAAGTAGCTATAGATGA
TATTCGTGTGAGTCCTTTTCAGCCTCGTCGAGTATTCTCTAATGAGGAGC
TGCAAGAATTAATAGCGTCGATAAAAGCTGTAGGTTTGATTCATCCTCCT
GTAGTGCGTGAAATTTGCACTGGAGATCGGGTGTTATATTATGAGCTTAT
TGCTGGCGAGCGCCGCTGGCGGGCCATGCAGCTCGCAGGAGCAACTACGA
TACCTGTGATTCTCAAGCATGTCATTGCTGATGGTACTGCTGCAGAAGCT
ACATTGATTGAGAACATCCAAAGGGTAAATTTAAACCCTATAGAAATGGC
TGAGGCCTTTAAAAGATTAATTCATGTCTTTGGACTCACTCAGGACAAAG
TTGCTTATAAAGTAGGGAAAAAACGTTCTACAGTAGCAAATTATTTGCGG
TTACTTGCTCTTTCTAAGACGATCCAGGAAAGCTTGTTGCAGGGTCAGAT
TACTCTCGGCCATGCTAAAGTCATCTTGACTCTGGAAGATCCTATACTTA
GGGAAAAGCTGAATGAGATCATCATACAAGAGCATTTGGCAGTACGTGAA
GCGGAACTGATAGCGAAGCAGCTTATAAGTGAAGAGGGCTCTTCGATAGA
GTTGAAGCCCACTCCTTTAGACATGGCAGAGTCGTCAAAGCAGCATGAAG
AATTGCAACAACGTCTCAGTGATCTTTGTGGGTATAAGGTCCAGATAAAA
ACCCGGGGATCAAAGGCTACAGTCTCTTTTCATTTGCAAAATACTCAGGA
TCTTCAAAAGTTGGAAGCTTGGCTTTCCAGCCATGGGACACTCAGTGAGA
GTCTATCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy