Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR541 IGR548 IGR544 IGR540 IGR547 IGR542 IGR546 IGR545 IGR543 IGR539 CPn0686 CPn0681 spoJ,parB, - CPn0684 pgk, - CPn0679 yfhO,nifS, - CPn0689 CPn0690 ygo4, - CPn0680 CPn0685 CPn0687 CPn0688 dppF, - CPn0683 CPn0686 CPn0681 spoJ,parB, - CPn0684 pgk, - CPn0679 yfhO,nifS, - CPn0689 CPn0690 ygo4, - CPn0680 CPn0685 CPn0687 CPn0688 dppF, - CPn0683 CPn0686 CPn0681 spoJ,parB, - CPn0684 pgk, - CPn0679 CPn0690 ygo4, - CPn0680 yfhO,nifS, - CPn0689 CPn0685 CPn0687 CPn0688 dppF, - CPn0683 dppD, - CPn0682 dppD, - CPn0682
* Calculated from Protein Sequence

Gene ID: CPn0683

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dppF  

Definition:
oligopeptide transport ATP-binding protein

Gene Start:
765948

Gene Stop:
766922

Gene Length:
975

Molecular Weight*:
36788

pI*:
9.90

Net Charge*:
13.79

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to oligopeptide and dipeptide ABC transporter sequences; e.g. residues 9-272 are 70% similar to CT689, an oligopeptide transport ATP-binding protein; residues 139-303 are 47% similar to MG080, an oligopeptide ABC transporter, ATP-binding protein; residues 38-256 are 36% similar to UU560, an oligopeptide transport system permease protein; residues 9-312 are 37% similar to (AE001766) oligopeptide ABC transporter, ATP-binding protein [Thermotoga maritima]; and residues 7-305 are 37% similar to DPPF_ECOLI.

COGS Summary:  COGS Search
BeTs to 10 clades of COG1124
COG name: ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component
Functional Class:  E,P
The phylogenetic pattern of COG1124 is a-TK-qV-EB-HujGPo-IN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 51-62 and 160-191 represent blocks BL00211A-B (ABC transporters family proteins) with a combined E-value of 3.2e-23.

ProDom Summary:  Protein Domain Search
Residues 204-309 are 35% similar to a defined domain of O67885_AQUAE, defined as: ABC TRANSPORTER. ATP-BINDING; TRANSPORT.
Residues 159-202 are 68% similar to a defined domain of O25073_XXXXX, defined as: ATP-BINDING TRANSPORT PROTEIN TRANSPORTER ABC TRANSMEMBRANE MEMBRANE INNER RESISTANCE GLYCOPROTEIN.

Paralogs:  Local Blast Search
Numerous probable paralogs found in C.pneumoniae; CPn0682, CPn0201, CPn0202, CPn0542, CPn0191, CPn0413, CPn0231, CPn0248, CPn0348, CPn0723, and CPn0023. Residues 36-308 are 37% similar to CPn0682.

Pfam Summary:  Pfam Search
Residues 46 to 236 (E-value = 4.1e-53) place CPn0683 in the ABC_tran family which is described as ABC transporter (PF00005)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
39  
117

PDB Hit:


Gene Protein Sequence:
MTTNFPQPLIQATSLTKHYYKRSFWFQGKTIASRPVDDVSFSLYSRRAVG
LIGESGSGKSTLALALAGLLPLTSGFLTFNGTPIKLHSKHGRHQLRSQVR
LVFQNPQASLNPRKTILDSLGHSLLYHKLVPKEKVLATVREYLELVGLSE
EYFYRYPHQLSGGQQQRVSIARALLGVPQLIICDEIVSALDLSIQAQILN
MLAELQKKLSLTYLFISHDLAVVRSFCTEVFIMYKGQIVEKGNTKRIFSD
PQHPYTRMLLNAQLPETPDQRQSKPIFQEYHKDSEESCSTGCYFYNRCPQ
KQEACKSEIIPNQGDAHHTYRCIH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACGACTAATTTTCCCCAACCTTTAATTCAAGCAACCTCATTAACAAA
GCACTATTACAAGCGTTCCTTTTGGTTTCAGGGAAAGACAATTGCCAGTC
GTCCTGTTGACGACGTCTCTTTTTCACTATACTCCAGACGTGCTGTCGGA
CTTATTGGAGAATCTGGATCAGGGAAAAGTACCCTGGCGTTAGCTCTCGC
AGGTCTCCTACCTCTCACCTCTGGGTTCTTAACTTTTAACGGCACCCCAA
TCAAGTTGCATTCTAAACACGGACGCCATCAATTACGATCTCAAGTACGG
TTGGTCTTTCAAAATCCACAAGCTTCATTAAACCCGCGAAAAACTATCCT
AGATAGTTTAGGCCACTCTCTGCTTTACCATAAACTCGTCCCAAAAGAAA
AAGTACTAGCAACGGTAAGGGAATATTTAGAATTGGTAGGGTTATCTGAG
GAGTATTTTTATCGTTATCCTCACCAGCTTTCTGGAGGACAACAACAACG
AGTCTCTATAGCGAGAGCCCTATTAGGAGTCCCTCAGTTAATTATTTGTG
ACGAAATTGTTTCTGCTCTAGATTTATCTATTCAAGCACAAATTCTGAAT
ATGCTTGCCGAGCTGCAAAAAAAACTCAGCCTCACATATCTCTTCATTTC
GCATGATCTTGCCGTTGTACGCTCGTTCTGCACAGAGGTATTCATTATGT
ATAAGGGGCAAATTGTAGAAAAAGGAAATACAAAACGCATTTTTTCTGAT
CCACAACATCCTTATACGCGCATGTTGTTAAATGCCCAACTTCCAGAGAC
TCCTGATCAAAGGCAATCTAAACCTATATTCCAAGAATATCACAAAGATT
CTGAAGAATCTTGCTCTACAGGATGCTACTTTTACAATCGTTGTCCACAA
AAACAAGAAGCTTGCAAGTCAGAGATCATCCCAAATCAAGGAGACGCGCA
CCATACATACCGTTGTATCCATTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy