Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR541 IGR544 IGR540 IGR547 IGR542 IGR546 IGR545 IGR543 IGR538 IGR539 CPn0686 CPn0678 CPn0681 spoJ,parB, - CPn0684 pgk, - CPn0679 yfhO,nifS, - CPn0689 ygo4, - CPn0680 CPn0685 CPn0687 CPn0688 dppD, - CPn0682 CPn0686 CPn0678 CPn0681 spoJ,parB, - CPn0684 pgk, - CPn0679 yfhO,nifS, - CPn0689 ygo4, - CPn0680 CPn0685 CPn0687 CPn0688 dppD, - CPn0682 Type: tandem, Name:  - 10 CPn0686 CPn0678 CPn0681 spoJ,parB, - CPn0684 pgk, - CPn0679 yfhO,nifS, - CPn0689 ygo4, - CPn0680 CPn0685 CPn0687 CPn0688 dppD, - CPn0682 dppF, - CPn0683 dppF, - CPn0683
* Calculated from Protein Sequence

Gene ID: CPn0682

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dppD  

Definition:
dipeptide transport ATP-binding protein

Gene Start:
764984

Gene Stop:
765958

Gene Length:
975

Molecular Weight*:
35937

pI*:
7.70

Net Charge*:
3.46

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to oligopeptide and dipeptide ABC transporter sequences; e.g. residues 1-323 are 61% similar to CT690, a predicted dipeptide transport ATP-binding protein; residues 8-324 are 33% similar to UU560, a predicted oligopeptide transport system permease protein; residues 1-321 are 31% similar to MG079, a predicted oligopeptide ABC transporter, ATP-binding protein; residues 26-322 are 46% similar to (AE001726) oligopeptide ABC transporter, ATP-binding protein [Thermotoga maritima]; residues 6-321 are 40% similar to OPPD_BACSU; and residues 4-320 are 42% similar to (AF042861) putative OppD [Treponema denticola].

COGS Summary:  COGS Search
BeTs to 10 clades of COG0444
COG name: ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component
Functional Class:  E,P
The phylogenetic pattern of COG0444 is a-TKyqV-EB-Hujgpo-IN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 41-52 and 157-188 represent blocks BL00211A-B (ABC transporters family proteins) with a combined E-value of 2.8e-21.

ProDom Summary:  Protein Domain Search
Residues 87-265 are 30% similar to a defined domain of O34159_SALTY, defined as: PUTATIVE ATPASE.
Residues 156-199 are 75% similar to a defined domain of DPPD_EVOLI, defined as: ATP-BINDING TRANSPORT PROTEIN TRANSPORTER ABC TRANSMEMBRANE MEMBRANE INNER RESISTANCE GLYCOPROTEIN.

Paralogs:  Local Blast Search
Several probable paralogs found in C.pneumoniae: CPn0201, CPn0683, CPn0202, CPn0280, CPn0248, CPn0542, CPn0723, CPn0413, CPn0191, and CPn0231. Residues 4-257 are 36% similar to CPn0201.

Pfam Summary:  Pfam Search
Residues 36 to 233 (E-value = 4.5e-52) place CPn0682 in the ABC_tran family which is described as ABC transporter (PF00005)

PDB Hit:


Gene Protein Sequence:
MASNPILQIEDLSITLAKQRQQYPIVQSLSFTINEGQTLAIIGESGSGKS
VSAHAILRLLPCPPFSVSGQVNFQGHNLLTASRSIQKKIIGTEISMIFQN
PQASLNPVFTIEQQFREIIHTHLALTAEVAKEKMLYALEETGFHDPRLCL
NLYPHQLSGGMLQRICIAMALLCSPKLLIADEPTTALDVSVQYQILQLLK
TLQKKTGMSLLIITHNMGVVAETADDVLVLYAGRMVECAPAVQMFHNPSH
PYTRDLLASRPSLQPQQLGSFNPIPGQPPHYTAFPSGCRYHPRCSKILNR
CSAEAPEIYPVREGHKVRCWLYDD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTTCTAATCCCATTTTACAGATAGAGGATCTATCCATAACCTTGGC
AAAACAACGCCAACAGTACCCCATCGTCCAATCTTTATCGTTTACTATCA
ATGAAGGACAAACCTTAGCAATCATTGGAGAATCAGGATCAGGAAAATCT
GTCTCTGCGCATGCAATCCTTCGATTACTTCCTTGCCCCCCATTTTCTGT
TTCTGGCCAGGTCAACTTCCAAGGCCACAACTTACTTACGGCTTCGCGCT
CTATACAAAAAAAGATTATAGGGACAGAAATTTCTATGATCTTTCAAAAC
CCGCAAGCATCTCTAAACCCCGTGTTTACTATTGAACAGCAGTTTCGAGA
AATTATTCATACCCACCTAGCCTTAACTGCAGAAGTTGCTAAAGAAAAGA
TGTTATACGCTCTTGAAGAAACAGGGTTTCATGATCCCAGGCTGTGCTTG
AATCTCTACCCCCACCAACTCTCTGGAGGGATGCTTCAAAGAATTTGCAT
TGCCATGGCGCTCCTCTGTTCTCCTAAACTTCTTATTGCTGATGAACCTA
CGACTGCTTTAGATGTTTCTGTTCAGTATCAGATTCTACAATTACTAAAA
ACACTACAGAAAAAAACGGGAATGAGCCTTCTTATTATTACCCATAATAT
GGGAGTCGTTGCAGAAACTGCTGATGACGTGCTCGTGCTCTATGCAGGAC
GCATGGTAGAATGTGCCCCTGCGGTTCAAATGTTCCATAATCCTTCTCAT
CCCTATACCCGAGATCTTTTAGCATCCAGACCCTCTCTACAACCGCAACA
ACTAGGTTCCTTCAACCCCATTCCAGGACAGCCCCCACACTACACGGCCT
TTCCCTCGGGATGTCGCTATCACCCTAGATGCTCAAAAATTTTAAATCGA
TGTTCTGCGGAAGCTCCAGAAATCTATCCGGTACGCGAAGGTCACAAAGT
AAGGTGTTGGCTGTATGACGACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy