Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR541 IGR544 IGR540 IGR542 IGR546 IGR545 IGR543 IGR538 IGR539 CPn0686 CPn0678 CPn0681 spoJ,parB, - CPn0684 CPn0677 pgk, - CPn0679 ygo4, - CPn0680 CPn0685 CPn0687 CPn0688 dppF, - CPn0683 CPn0686 CPn0678 CPn0681 spoJ,parB, - CPn0684 CPn0677 pgk, - CPn0679 ygo4, - CPn0680 CPn0685 CPn0687 CPn0688 dppF, - CPn0683 Type: tandem, Name:  - 10 CPn0686 CPn0678 CPn0681 spoJ,parB, - CPn0684 CPn0677 pgk, - CPn0679 ygo4, - CPn0680 CPn0685 CPn0688 dppF, - CPn0683 dppD, - CPn0682 dppD, - CPn0682 CPn0687
* Calculated from Protein Sequence

Gene ID: CPn0681

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (acidic)

Gene Start:
764929

Gene Stop:
764255

Gene Length:
675

Molecular Weight*:
25873

pI*:
5.00

Net Charge*:
-7.87

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
Conserved hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0681 is orthologously related to CT691: residues 1-224 of CPn0681 are 60% similar to residues 1-224 of CT691, a predicted conserved hypothetical protein from C. trachomatis. Numerous hits in gapped BLAST to conserved hypothetical proteins, i.e., 32% and 25% similarity to accession BAA29728 and BAA30495 (Pyrococcus horikoshii), respectively, 26% similarity to accession P4427 (Haemophilus influenzae), among others.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1392
COG name: Uncharacterized ACR
Functional Class:  S
The phylogenetic pattern of COG1392 is A-tK--V--b-h------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 4 to 223 (E-value = 1.3e-70) place CPn0681 in the PhoU_div family which is described as Protein of unknown function DUF47 (PF01865)

PDB Hit:


Gene Protein Sequence:
MQTLARLFGQSPFAPLQAHLEMVVSCVEYMLPIFTALRDGRYEELLEMAK
LVSDKEYQADCIKNDMRNHLPAGLFMPISRAGILEIISIQDSIADTAEDV
AILLTIRRLNFYPSMETLFFRFLEKNLEAFELTMTLLHEFNQLLESSFGG
RKADKARLLVGRVAKSEHESDVLQRELMQIFFSDDFIIPEKEFYLWLQVI
RRTAGISDSSEKLAHRINMTLEEK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAACCCTTGCTCGTCTATTTGGCCAATCTCCATTTGCTCCTTTACA
AGCTCATCTGGAAATGGTGGTCTCTTGTGTGGAATACATGCTTCCTATAT
TCACTGCTCTCCGAGATGGAAGATATGAAGAATTATTAGAAATGGCAAAA
CTTGTTTCTGATAAAGAGTATCAAGCAGATTGTATAAAAAATGATATGAG
GAATCATCTTCCTGCAGGATTATTCATGCCGATATCTCGAGCGGGGATTC
TAGAAATTATTTCTATACAAGATAGCATCGCGGATACTGCTGAAGATGTT
GCTATCTTATTAACCATCAGACGATTAAACTTTTATCCATCTATGGAAAC
GCTTTTTTTCCGATTTTTGGAAAAAAATCTAGAAGCTTTTGAGTTAACTA
TGACATTGCTACATGAATTCAACCAATTGCTTGAAAGTTCATTTGGGGGG
AGGAAGGCAGATAAAGCACGCTTGCTTGTAGGGCGTGTGGCTAAATCTGA
ACATGAATCGGATGTTTTGCAACGAGAACTTATGCAAATATTTTTTTCTG
ATGATTTTATAATTCCTGAAAAAGAGTTTTATCTTTGGTTACAAGTAATT
CGACGCACTGCGGGGATTTCAGATAGTTCTGAAAAGCTCGCACATAGAAT
TAATATGACCCTAGAAGAAAAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy