Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR541 IGR544 IGR537 IGR540 IGR542 IGR545 IGR543 IGR538 IGR539 CPn0686 CPn0678 CPn0681 spoJ,parB, - CPn0684 CPn0677 CPn0676 pgk, - CPn0679 ygo4, - CPn0680 CPn0685 CPn0687 dppF, - CPn0683 CPn0686 CPn0678 CPn0681 spoJ,parB, - CPn0684 CPn0677 CPn0676 pgk, - CPn0679 ygo4, - CPn0680 CPn0685 CPn0687 dppF, - CPn0683 Type: tandem, Name:  - 10 CPn0686 CPn0678 CPn0681 spoJ,parB, - CPn0684 CPn0677 CPn0676 pgk, - CPn0679 ygo4, - CPn0680 CPn0687 dppF, - CPn0683 dppD, - CPn0682 dppD, - CPn0682 CPn0685
* Calculated from Protein Sequence

Gene ID: CPn0680

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ygo4  

Definition:
phosphate permease/transporter

Gene Start:
764248

Gene Stop:
762968

Gene Length:
1281

Molecular Weight*:
45549

pI*:
10.30

Net Charge*:
14.38

EC:
 

Functional Class:
transport and binding proteins; anions  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to putative phosphate permease sequences; e.g. residues 4-425 are 64% similar to CT692, a predicted phosphate permease/transporter; residues 9-417 are 39% similar to (X98130) putative phosphate permease [Arabidopsis thaliana]; residues 9-417 are 38% similar to (U84890) putative phosphate permease [Mesembryanthemum crystallinum]; and residues 4-426 are 35% similar to YG04_HAEIN.
No significant similarity to T.pallidum, M.genitalium, and U.urealyticum.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0306
COG name: Phosphate permease
Functional Class:  P
The phylogenetic pattern of COG0306 is AmtKy-V-EBRhuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 10-381 span four regions of similarity to blocks PF01384A-B (Phosphate transporter family) with a combined E-value of 7.2e-12.

ProDom Summary:  Protein Domain Search
Residues 9-165 are 50% similar to a defined domain of Q38954_ARATH, defined as: PHOSPHATE PERMEASE PROTEIN PUTATIVE TRANSPORT TRANSMEMBRANE TRANSPORTER RECEPTOR INNER MEMBRANE.
Residues 262-418 are 49% similar to a defined domain of O28476_ARCFU, defined as: PHOSPHATE PERMEASE PROTEIN PUTATIVE TRANSPORT TRANSMEMBRANE TRANSPORTER RECEPTOR INNER MEMBRANE.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 19 to 414 (E-value = 3.3e-195) place CPn0680 in the PHO4 family which is described as Phosphate transporter family (PF01384)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
21
transmembrane  
37  
55
transmembrane  
87  
104
transmembrane  
114  
138
transmembrane  
143  
160
transmembrane  
175  
195
transmembrane  
207  
224
transmembrane  
265  
283
transmembrane  
288  
307
transmembrane  
312  
329
transmembrane  
354  
378
transmembrane  
391  
415

PDB Hit:


Gene Protein Sequence:
MLPLIIFVLLCGFYTSWNIGANDVANAVGPSVGSGVLTLRQAVVIAAIFE
FFGALLLGDRVAGTIESSIVSVTNPMIASGDYMYGMTAALLATGVWLQLA
SFFGWPVSTTHSIVGAVIGFGLVLGKGTIIYWNSVGIILISWILSPFMGG
CVAYLIFSFIRRHIFYKNDPVLAMVRVAPFLAALVIMTLGTVMISGGVIL
KVSSTPWAVSGVLVCGLLSYIITFYYVHTKHCSYISDTPKKGSLTYRLKE
RGGNYGRKYLVVERIFAYLQIIVACFMAFAHGSNDVANAIAPVAGVLRQA
YPASYTSYTLIRLMAFGGIGLVIGLAIWGWRVIETVGCKITELTPSRGFS
VGMGSALTIALASILGLPISTTHVVVGAVLGIGLARGIRAINLNIIKDIV
LSWFITLPAGALLSILFFFALRALFH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTTCCATTAATCATTTTTGTCCTTCTATGTGGCTTTTATACTTCTTG
GAATATAGGAGCTAATGATGTCGCTAATGCTGTAGGCCCTAGTGTAGGAT
CTGGGGTATTGACATTGCGACAAGCCGTGGTCATCGCTGCTATCTTTGAG
TTTTTTGGTGCTCTCCTTCTTGGAGATCGTGTTGCAGGGACTATAGAAAG
TAGTATCGTTTCTGTGACCAATCCTATGATTGCCTCTGGGGACTATATGT
ACGGCATGACGGCAGCCTTACTAGCAACAGGCGTGTGGTTGCAGCTGGCC
TCTTTTTTTGGTTGGCCCGTCTCAACAACGCATTCTATAGTTGGAGCTGT
GATTGGCTTTGGATTGGTCCTTGGTAAGGGAACAATCATTTACTGGAATT
CCGTAGGCATTATTTTAATTAGCTGGATTCTCTCCCCTTTTATGGGTGGG
TGTGTTGCTTACCTGATCTTTTCTTTCATTCGGCGCCATATTTTTTATAA
GAATGATCCTGTTCTTGCTATGGTTCGTGTTGCTCCGTTTTTAGCAGCTT
TGGTGATCATGACTTTAGGAACCGTGATGATCTCTGGGGGCGTGATCCTT
AAGGTTTCTTCAACTCCCTGGGCAGTTAGTGGGGTTCTGGTTTGTGGACT
TCTAAGTTATATCATTACGTTTTACTACGTCCATACCAAGCACTGTTCCT
ACATTTCAGATACACCAAAAAAAGGCAGTCTTACCTATCGTTTGAAAGAA
CGAGGCGGAAATTATGGAAGAAAGTATCTTGTTGTAGAAAGAATCTTTGC
CTACCTACAGATTATCGTAGCTTGCTTTATGGCGTTTGCTCACGGATCTA
ATGATGTTGCTAATGCCATTGCTCCTGTAGCTGGAGTCTTGCGTCAGGCA
TATCCTGCTTCCTATACGTCGTATACATTAATTAGGCTCATGGCATTTGG
AGGCATAGGCTTGGTCATAGGCCTTGCGATTTGGGGATGGCGTGTTATAG
AAACTGTAGGCTGTAAAATTACCGAGTTAACCCCGTCTCGAGGGTTTTCC
GTGGGGATGGGCTCAGCATTAACAATTGCTTTAGCTTCTATTTTAGGACT
TCCTATATCTACGACACATGTTGTTGTTGGAGCTGTTTTAGGAATAGGTT
TAGCACGAGGGATCCGTGCCATTAACTTAAACATTATCAAAGATATTGTA
CTCTCCTGGTTTATTACGCTTCCTGCAGGAGCTTTATTATCCATACTCTT
TTTCTTTGCTTTAAGAGCTTTGTTCCATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy