Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR541 IGR537 IGR540 IGR542 IGR536 IGR543 IGR538 IGR539 CPn0678 CPn0681 spoJ,parB, - CPn0684 CPn0677 CPn0675 CPn0676 pgk, - CPn0679 ygo4, - CPn0680 dppD, - CPn0682 CPn0678 CPn0681 spoJ,parB, - CPn0684 CPn0677 CPn0675 CPn0676 pgk, - CPn0679 ygo4, - CPn0680 dppD, - CPn0682 Type: tandem, Name:  - 10 CPn0678 CPn0681 spoJ,parB, - CPn0684 CPn0677 CPn0675 CPn0676 pgk, - CPn0679 ygo4, - CPn0680 dppD, - CPn0682 dppF, - CPn0683 dppF, - CPn0683
* Calculated from Protein Sequence

Gene ID: CPn0679

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pgk  

Definition:
phosphoglycerate kinase

Gene Start:
762930

Gene Stop:
761722

Gene Length:
1209

Molecular Weight*:
43034

pI*:
6.50

Net Charge*:
-3.19

EC:
 

Functional Class:
energy metabolism; glycolysis/gluconeogenesis  

Pathway: pathway table
Energy Metabolism; Carbon fixation
Metabolism; Glycolysis / Gluconeogenesis

Comment:


Blast Summary:  PSI-Blast Search
CPn0679 is similar to TP0538 in T. pallidum,
MG300 in M. genitalium and UU279 in U. urealyticum.

CPn0679 is orthologously related to CT693, a predicted phosphoglycerate kinase.
Residues 1-402 are 72% similar to CT693.

COGS Summary:  COGS Search
BeTs to 16 clades of COG0126
COG name: 3-phosphoglycerate kinase
Functional Class:  G
The phylogenetic pattern of COG0126 is amtkyqvcebrhujgpolin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 401 (E-value = 1.7e-189) place CPn0679 in the PGK family which is described as Phosphoglycerate kinase (PF00162)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
314  
402

PDB Hit:


Gene Protein Sequence:
MDKLTVQDLSPEEKKVLVRVDFNVPMQDGKILDDIRIRSAMPTINYLLKK
HAAVILMSHLGRPKGQGFQEEYSLQPVVDVLEGYLGHHVPLAPDCVGEVA
RQAVAQLSPGRVLLLENLRFHIGEEHPEKDPTFAAELSSYGDFYVNDAFG
TSHRKHASVYVVPQAFPGRAAAGLLMEKELEFLGRHLLTSPKRPFTAILG
GAKISSKIGVIEALLNQVDYLLLAGGMGFTFLQALGKSLGNSLVEKSALD
LARNVLKIAKSRNVTIVLPSDVKAAENLQSKEYSVISIDQGIPPHLQGFD
IGPRTTEEFIRIINQSATVFWNGPVGVYEVPPFDSGSIAIANALGNHPSA
VTVVGGGDAAAVVALAGCSTKVSHVSTGGGASLEFLEQGFLPGTEVLSPS
KS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATAAGCTAACAGTACAAGATCTTTCTCCAGAAGAAAAAAAAGTCCT
CGTACGTGTAGATTTCAATGTCCCCATGCAAGATGGCAAGATACTCGATG
ACATTCGTATTCGCAGTGCGATGCCTACAATCAACTATCTACTTAAGAAA
CATGCTGCAGTGATTTTAATGAGTCATTTAGGGCGACCTAAAGGACAGGG
GTTCCAAGAGGAATATTCTCTGCAACCCGTTGTGGATGTTCTCGAAGGAT
ACTTAGGACATCATGTGCCTCTAGCTCCAGATTGTGTGGGTGAGGTTGCA
CGTCAAGCTGTAGCTCAGCTTTCTCCTGGTCGCGTTTTGCTTCTTGAGAA
CTTGCGTTTCCATATAGGAGAAGAACATCCAGAAAAAGACCCGACGTTCG
CCGCAGAACTCTCTTCCTACGGGGATTTCTATGTCAACGATGCTTTCGGA
ACTTCGCATAGAAAACATGCTTCAGTCTATGTAGTGCCGCAGGCTTTCCC
AGGTAGAGCCGCAGCAGGCCTGCTTATGGAAAAAGAATTGGAATTTTTAG
GAAGACATCTATTGACCTCCCCTAAGAGGCCTTTCACTGCCATCCTTGGA
GGAGCTAAGATTTCTTCTAAAATTGGAGTTATAGAGGCTCTACTGAATCA
AGTAGACTACCTCTTATTAGCTGGAGGTATGGGATTTACTTTCCTACAAG
CCTTGGGAAAATCCCTAGGGAACTCTCTTGTGGAGAAATCTGCCTTGGAT
CTTGCTAGAAATGTATTGAAAATTGCTAAAAGTCGTAATGTTACCATAGT
TTTGCCTAGCGATGTGAAAGCAGCCGAAAATCTCCAATCTAAGGAATATT
CTGTGATTTCTATAGATCAAGGCATTCCTCCGCATCTTCAAGGCTTTGAT
ATTGGACCTAGAACAACCGAAGAATTTATCCGTATTATAAACCAATCAGC
GACTGTGTTTTGGAATGGTCCTGTGGGTGTTTATGAGGTCCCTCCTTTTG
ACTCTGGATCTATTGCTATAGCGAATGCCTTAGGCAATCACCCTTCAGCT
GTTACTGTCGTGGGTGGAGGAGATGCGGCAGCTGTGGTTGCTTTGGCAGG
CTGCTCTACAAAAGTTTCCCATGTTTCTACTGGAGGAGGGGCTTCTTTAG
AGTTTCTAGAGCAGGGCTTCCTCCCAGGTACAGAAGTTTTATCTCCATCC
AAAAGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy