Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR541 IGR537 IGR540 IGR542 IGR535 IGR536 IGR538 IGR539 CPn0678 CPn0681 fmu, - CPn0674 CPn0677 CPn0675 CPn0676 pgk, - CPn0679 ygo4, - CPn0680 dppD, - CPn0682 CPn0678 CPn0681 fmu, - CPn0674 CPn0677 CPn0675 CPn0676 pgk, - CPn0679 ygo4, - CPn0680 dppD, - CPn0682 Type: tandem, Name:  - 10 CPn0678 CPn0681 fmu, - CPn0674 CPn0677 CPn0675 CPn0676 pgk, - CPn0679 ygo4, - CPn0680 dppD, - CPn0682 dppF, - CPn0683 dppF, - CPn0683
* Calculated from Protein Sequence

Gene ID: CPn0678

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
761320

Gene Stop:
760679

Gene Length:
642

Molecular Weight*:
21785

pI*:
11.80

Net Charge*:
21.18

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 70-191 are 29% similar to a defined domain of O60432_HUMAN. This relates to a weak E-value of 1.6e-05, and in consideration of the alignment, seems to be spurious.

Paralogs:  Local Blast Search
Single probable paralog in C.pneumoniae, a predicted hypothetical protein:

Residues 1-179 are 33% similar to residues 1-134 of CPn0677.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
213

PDB Hit:


Gene Protein Sequence:
MSVNPSGNSKNDLWITGAHDQHPDVKESGVTSANLGSHRVTASGGRQGLL
ARIKEAVTGFFSRMSFFRSGAPRGSQQPSAPSADTVRSPLPGGDARATEG
AGRNLIKKGYQPGMKVTIPQVPGGGAQRSSGSTTLKPTRPAPPPPKTGGT
NAKRPATHGKGPAPQPPKTGGTNAKRAATHGKGPAPQPPKGILKQPGQSG
TSGKKRVSWSDED$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTGTTAATCCATCAGGAAATTCCAAGAACGATCTCTGGATTACGGG
AGCTCATGATCAGCATCCCGATGTTAAAGAATCCGGGGTTACAAGTGCTA
ACCTAGGAAGTCATAGAGTGACTGCCTCAGGAGGACGCCAAGGGTTATTA
GCACGAATCAAAGAAGCAGTAACCGGGTTTTTTAGTCGGATGAGCTTCTT
CAGATCGGGAGCTCCAAGAGGTAGCCAACAACCCTCTGCTCCATCTGCAG
ATACTGTACGTAGCCCGTTGCCGGGAGGGGATGCTCGCGCTACCGAGGGA
GCTGGTAGGAACTTAATTAAAAAAGGGTACCAACCAGGGATGAAAGTCAC
TATCCCACAGGTTCCTGGAGGAGGGGCCCAACGTTCATCAGGTAGCACGA
CACTAAAGCCTACGCGTCCGGCACCCCCACCTCCTAAAACGGGTGGAACT
AATGCAAAACGTCCGGCAACGCACGGGAAGGGTCCAGCACCCCAGCCTCC
TAAAACAGGTGGGACCAATGCTAAGCGCGCAGCAACGCATGGGAAAGGTC
CAGCACCTCAACCTCCTAAGGGCATTTTGAAACAGCCTGGGCAGTCTGGG
ACTTCAGGAAAGAAGCGTGTCAGCTGGTCTGACGAAGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy